Items where Subject is "H Social Sciences > HB Economic Theory"

Up a level
Export as [feed] Atom [feed] RSS 1.0 [feed] RSS 2.0
Group by: Creators | Item Type
Jump to: A | B | C | D | E | F | G | H | I | J | K | L | M | N | O | P | R | S | T | U | V | W | Y | Z
Number of items at this level: 994.

A

ABABIL, SALSABILA (2022) STRATEGI PENCEGAHAN POLIS LAPSE AKIBAT KETERLAMBATAN DALAM PEMBAYARAN PREMI LANJUTAN PADA PT. BNI LIFE INSURANCE KANTOR PEMASARAN MANDIRI TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

ABDUL AZIS, SEPTIAN (2019) ANALISIS PENGARUH PENANAMAN MODAL DALAM NEGERI (PMDN), PENANAMAN MODAL ASING (PMA), DAN BELANJA MODAL TERHADAP PERTUMBUHAN EKONOMI PROVINSI JAWA BARAT TAHUN 2007-2017. Sarjana thesis, Universitas Siliwangi.

ABDUL WAHAB, ADE (2020) ENGARUH CORPORATE SOCIAL RESPONSIBILITY TERHADAP NILAI PERUSAHAAN (Sensus pada Perusahaan Manufaktur Sub Sektor Plastik dan Kemasan di Bursa Efek Indonesia yang listing pada tahun 2018). Sarjana thesis, Universitas Siliwangi.

ACHMAD, ILLA TAHIRA (2021) ANALISIS KEPUASAN KONSUMEN PADA RUMAH MAKAN SANDING RESTO DI KABUPATEN GARUT. Sarjana thesis, Universitas Siliwangi.

ADAM, WILLY (2020) ANALISIS PENJUALAN USAHA BAKSO DI KOTA TASIKMALAYA (Sensus untuk Penjualan Langsung dan Go-Food). Sarjana thesis, Universitas Siliwangi.

ADELINA, MITHA (2022) ANALISIS PERMINTAAN MINUMAN KOPI ( Studi Kasus Kedai Kopi di Kelurahan Pejuang Kota Bekasi). Sarjana thesis, Universitas Siliwangi.

ADHA PERDANA, PUTRA DIFA (2020) PENGARUH DIGITAL LITERACY, STRATEGIC INTEGRATION, DAN PERCEIVED EASE OF USE TERHADAP COMPETITIVE ADVANTAGE (Kasus Pengguna Layanan OVO di Grab Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

ADHIYANI, DESI WULAN (2019) PENGARUH IKLIM ORGANISASI DAN STRES KERJA TERHADAP KINERJA DENGAN BURNOUT SEBAGAI VARIABEL INTERVENING (Sensus pada Perawat Pelaksana di Ruang Rawat Inap RSUD dr. Soekardjo Kota Tasikmalaya). Pascasarjana thesis, Universitas Siliwangi.

ADITIA, ANGGI (2019) PENGARUH SELF ESTEEM DAN KEMANDIRIAN BELAJAR TERHADAP PRESTASI BELAJAR MAHASISWA PENDIDIKAN EKONOMI ANGKATAN 2016 DAN ANGKATAN 2017 UNIVERSITAS SILIWANGI (Survei Pada Mahasiswa Pendidikan Ekonomi Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

ADJI, TSANY HILMYANA (2019) ANALISIS PENDAPATAN RUMAH MAKAN SEAFOOD DI KECAMATAN PANGANDARAN. Sarjana thesis, Universitas Siliwangi.

ADOLPO, ANTONIO (2021) MEMBANGUN BRAND TRUST DAN MEMBANGKITKAN BRAND RESONANCE DENGAN BRAND DISTINCTIVENESS MELALUI BRAND ATTRACTIVENESS DAN BRAND IDENTIFICATION (Kasus Pada Pengguna Sepatu Olahraga Nike di Indonesia). Sarjana thesis, Universitas Siliwangi.

AFRERA, ADELINE (2020) ANALISIS DETERMINAN KETIMPANGAN PENDAPATAN ANTAR KABUPATEN/KOTA DI PROVINSI DAERAH ISTIMEWA YOGYAKARTA PERIODE 2000-2018. Sarjana thesis, Universitas Siliwangi.

AFRIANA, ARY (2021) PENGARUH MEDIA SOSIAL DAN KONFORMITAS TERHADAP GAYA HIDUP SERTA IMPLIKASINYA TERHADAP PERILAKU KONSUMTIF (Survey Pada Mahasiswa Jurusan Akuntansi Fakultas Ekonomi dan Bisnis Universitas Siliwangi Tahun Angkatan 2017). Sarjana thesis, Universitas Siliwangi.

AGNIYA, IKMAL FASHA (2020) PENGARUH INOVASI PRODUK DAN E-COMMERCE TERHADAP KEUNGGULAN BERSAING (Survey pada Pengusaha Handycraft di Desa Dawagung Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

AGSYAM, WILDANUL (2021) STRATEGI PEMASARAN TABUNGAN iB HIJRAH RENCANA DI BANK MUAMALAT INDONESIA (BMI) KCP SINGAPARNA. Diploma thesis, Universitas Siliwangi.

AGUSTIAN, MUHAMMAD AZMI (2021) PENGARUH PENGETAHUAN METAKOGNITIF TERHADAP EFIKASI DIRI DAN IMPLIKASINYA TERHADAP HASIL BELAJAR (Survei pada Siswa Kelas XI IPS Mata Pelajaran Ekonomi di SMA KHZ Musthafa Tahun Ajaran 2020/2021). Sarjana thesis, Universitas Siliwangi.

AGUSTIANI, RESTY (2021) PENERAPAN MODEL PEMBELAJARAN DISCOVERY LEARNING TERHADAP KEMAMPUAN BERFIKIR KREATIF PESERTA DIDIK (Studi Kuasi Eksperimen Pada Mata Pelajaran Ekonomi Kelas XI IPS SMA KHZ MUSTHAFA SUKAMANAH Semester Ganjil Tahun Ajaran 2020/2021). Sarjana thesis, Universitas Siliwangi.

AGUSTIANI, SELI (2022) STRATEGI PEMASARAN KREDIT USAHA RAKYAT (KUR) MIKRO DI MASA PANDEMI COVID-19 PADA PT. BANK TABUNGAN NEGARA (PERSERO) Tbk. KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

AGUSTIN, AZIS (2019) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI PRODUKSI IKAN KERAMBA JARING APUNG (KJA) DI WADUK CIRATA KABUPATEN CIANJUR. Sarjana thesis, Universitas Siliwangi.

AGUSTIN, TANTI NOVIANTY (2020) ANALISIS FINANCIAL DISTRESS DENGAN PENDEKATAN MODEL OHLSON PENGARUHNYA TERHADAP ACCOUNTING CONSERVATISM (Survey pada Perusahaan Computer Hardware and Technology yang Terdaftar di New York Stock Exchange – ARCA Periode 2016-2018). Sarjana thesis, Universitas Siliwangi.

AGUSTINA, DELIA (2022) PENGARUH EFFECTIVE TAX RATE, TUNNELING INCENTIVE DAN DEBT CONVENANT TERHADAP KEPUTUSAN TRANSFER PRICING (Survei pada Perusahaan Manufaktur yang Terdaftar di Bursa Efek Indonesia Periode Tahun 2017 – 2020). Sarjana thesis, Universitas Siliwangi.

AGUSTINA, SILVIA (2021) PENGARUH SIKAP KEWIRAUSAHAAN, PENDIDIKAN KEWIRAUSAHAAN DAN EFIKASI DIRI TERHADAP KESIAPAN BERWIRAUSAHA (Survei pada Mahasiswa di Lingkungan Fakultas Keguruan dan Ilmu Pendidikan Angkatan 2018 Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

AHMAD, USEP (2019) PENGARUH MODAL KERJA TERHADAP SISA HASIL USAHA (SHU) (Studi Kasus Pada KPRI Mustika Kecamatan Cisayong ) SKRIPSI Untuk Memenuhi Salah Satu Syarat Penulisan Skripsi Pada Program Studi Akuntansi Fakultas Ekonomi Oleh: USEP AHMAD 123403173 PROGRAM STUDI AKUNTANSI FAKULTAS EKONOMI UNIVERSITAS SILIWANGI TASIKMALAYA 2019. Sarjana thesis, Universitas Siliwangi.

AISYAH, DELINA RAHNI (2021) PENGARUH UKURAN PERUSAHAAN, PROFITABILITAS DAN DIVIDEND PER SHARE TERHADAP RETURN SAHAM (Sensus pada Perusahaan Manufaktur yang terdaftar di Bursa Efek Indonesia). Pascasarjana thesis, Universitas Siliwangi.

AJI, HAFIZH SATRIA (2020) PENGARUH PENDAPATAN, KARAKTERISTIK PEROKOK DAN KENAIKAN HARGA TERHADAP TINGKAT KONSUMSI ROKOK (Studi Kasus Pengemudi Ojek Online di Kota Depok). Sarjana thesis, Universitas Siliwangi.

AKBAR, MUHAMMAD ILHAM (2022) PENGARUH DISIPLIN DAN PELATIHAN TERHADAP KINERJA KARYAWAN (Suatu Penelitian Pada Karyawan Non Manajer PD. BPR Artha Galunggung Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

AKBAR, MUHAMMAD ILHAM (2022) PENGARUH DISIPLIN DAN PELATIHAN TERHADAP KINERJA KARYAWAN (Suatu Penelitian Pada Karyawan Non Manajer PD. BPR Artha Galunggung Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

AKBAR, REDIANA DWI (2022) PENGARUH PAJAK REKLAME DAN PAJAK HIBURAN TERHADAP PENDAPATAN ASLI DAERAH (Studi Kasus pada Badan Pengelola Pajak dan Retribusi Daerah Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

AL ZUHDI, HILMAN RABBANI (2020) FAKTOR-FAKTOR YANG MEMPENGARUHI PENDAPATAN PEDAGANG KAKI LIMA DI KECAMATAN CIAMIS KABUPATEN CIAMIS. Sarjana thesis, Universitas Siliwangi.

AL-GHASYIYAH, LAILA SYAHIFAH (2020) FAKTOR PENENTU OMZET KEDAI KOPI DI KECAMATAN TAWANG KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

ALGIFARI, FAHMI (2022) ANALISIS USAHA TANI KOPI ROBUSTA DI DESA KERTAMANDALA KECAMATAN PANJALU KABUPATEN CIAMIS. Sarjana thesis, Universitas Siliwangi.

ALIAH, NAILA SYA’ADATUL (2022) ANALISIS PENGARUH PDRB PERKAPITA, PENDIDIKAN, DAN PENGANGGURAN TERHADAP KEMISKINAN KABUPATEN / KOTA DI PROVINSI DAERAH ISTIMEWA YOGYAKARTA TAHUN 2011 – 2020. Sarjana thesis, Universitas Siliwangi.

AMALIA, KAMILA TASYA (2022) PROSEDUR PEMBIAYAAN MITRAGUNA DENGAN AKAD MURABAHAH PADA BANK SYARIAH INDONESIA (BSI) KANTOR CABANG TASIKMALAYA A YANI. Sarjana thesis, Universitas Siliwangi.

AMALIA, RIZKA (2020) PENGARUH KINERJA KEUANGAN PEMERINTAH DAERAH TERHADAP PEMBANGUNAN MANUSIA (Studi Kasus pada Pemerintah Kota Tasikmalaya Periode 2004-2018). Sarjana thesis, Universitas Siliwangi.

AMANDA, REZA (2020) IMPLEMENTASI SERVICE EXCELLENT CUSTOMER SERVICE PT. BANK PERKREDITAN RAKYAT SILIWANGI CABANG CIBOGOR DALAM MENINGKATKAN PELAYANAN NASABAH. Diploma thesis, Universitas Siliwangi.

AMELIA, ADE (2022) ANALISIS SYARIAH ENTERPRISE THEORY PADA PROGRAM CORPORATE SOCIAL RESPONSIBILITY DI BPRS AL-MADINAH TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

AMELIA, ADE (2022) ANALISIS SYARIAH ENTERPRISE THEORY PADA PROGRAM CORPORATE SOCIAL RESPONSIBILITY DI BPRS AL-MADINAH TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

AMELIA, RINA (2020) PENGARUH PROSES REKRUTMEN DAN SELEKSI TERHADAP KINERJA KARYAWAN (Suatu Penelitian Terhadap Karyawan Non Manajer Perusahaan Daerah Air Minum (PDAM) Tirta Sukapura Pusat Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

ANBAR FIRDAUS, DINDA (2019) PENGARUH PDB, KURS, INFLASI, DAN PAJAK TERHADAP PENANAMAN MODAL ASING DI INDONESIA TAHUN 2000-2017. Sarjana thesis, Universitas Siliwangi.

ANDANI, SARI (2019) PENERAPAN MODEL PEMBELAJARAN PROBLEM POSING DENGAN BANTUAN MEDIA PERMAINAN ULAR TANGGA UNTUK MENINGKATKAN HASIL BELAJAR SISWA (Studi Quasi Eksperimen Pada Mata Pelajaran Ekonomi Kelas X IPS SMA Negeri 6 Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

ANDINI, PUTRI (2022) PROSEDUR PEMBERIAN KREDIT BNI FLEKSI PADA PT BANK NEGARA INDONESIA (PERSERO) Tbk KANTOR KAS KAWALI CIAMIS. Diploma thesis, Universitas Siliwangi.

ANDRIAN SAPUTRA, YOGA (2020) PENGARUH DESKRIPSI KERJA, LINGKUNGAN KERJA DAN DISIPLIN KERJA TERHADAP STRES KERJA KARYAWAN. Sarjana thesis, Universitas Siliwangi.

ANDRIANI, MERLIN (2020) PENGARUH RETURN ON EQUITY (ROE), EARNING PER SHARE (EPS), DAN TOTAL ASSET TURNOVER (TATO) TERHADAP HARGA SAHAM (Pada PT. Ciputra Development, Tbk). Sarjana thesis, Universitas Siliwangi.

ANDRIYANA, ANDI (2018) PENGARUH KUALITAS PELAYANAN DAN PERSEPSI HARGA TERHADAP CITRA PERUSAHAAN (Studi Kasus Pada PO. Pariwisata Gapuraning Rahayu Ciamis). Sarjana thesis, Universitas Siliwangi.

ANGGRAENI, NOVITA (2022) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI RETURN SAHAM PADA PERUSAHAAN SEKTOR KEUANGAN YANG TERDAFTAR DI BURSA EFEK INDONESIA TAHUN 2005-2020. Sarjana thesis, Universitas Siliwangi.

ANGGRAENI, SILVIA NURUL (2020) PROSEDUR PENYALURAN KREDIT GUNA BHAKTI BAGI PEGAWAI NEGERI SIPIL PADA PT. BANK PEMBANGUNAN DAERAH JAWA BARAT BANTEN Tbk,KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

ANGGRAENI, WIDYA (2019) PENGARUH PERSEPSI SISWA TENTANG KOMPETENSI GURU (KOMPETENSI PEDAGOGIK, PROFESIONAL, KEPRIBADIAN DAN KOMPETENSI SOSIAL) TERHADAP MINAT BELAJAR SISWA (Penelitian Survey Terhadap Siswa Kelas XI Pada Mata Pelajaran Ekonomi di SMA Negeri 1 Manonjaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

ANGRAENI, VANIA (2020) PENGARUH CORPORATE SOCIAL RESPONSIBILITY DAN FIRM SIZE TERHADAP PROFITABILITAS (Survey pada Perusahaan Consumer Goods Industry yang Terdaftar di BEI Tahun 2016-2018). Sarjana thesis, Universitas Siliwangi.

ANI, FITRI (2020) PENGARUH TINGKAT PENDIDIKAN, UPAH MINIMUM REGIONAL, DAN INFLASI TERHADAP TINGKAT PENGANGGURAN DI KABUPATEN TASIKMALAYA TAHUN 2007-2019. Sarjana thesis, Universitas Siliwangi.

ANRIANI, CICA (2022) ANALISIS USAHA TANI PADI (Studi Kasus di Desa Hanum Kecamatan Dayeuhluhur Kabupaten Cilacap Tahun 2020). Sarjana thesis, Universitas Siliwangi.

ANWAR, FAIZAL (2022) PENGARUH HARGA, KUALITAS PRODUK, KUALITAS PELAYANAN DAN LABEL HALAL TERHADAP KEPUASAN PELANGGAN (Studi Kasus pada Konsumen Lazatto di Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

APRIADI, MUHAMMAD RIZAL (2022) PENGARUH PENGEMBANGAN PRODUK DAN KUALITAS PRODUK TERHADAP KEUNGGULAN BERSAING (Survey Pada Pabrik Tahu Bulat NVL Ciamis). Sarjana thesis, Universitas Siliwangi.

APRIANI, DESI (2022) FAKTOR FISIK DAN SPIRITUAL SEBAGAI PENENTU KESUKSESAN BERUSAHA (SURVEI TERHADAP PEDAGANG KAKI LIMA DI PASAR SIMPANG KABUPATEN TASIKMALAYA). Sarjana thesis, Universitas Siliwangi.

APRIANI, RINA (2022) ANALISIS DETERMINAN PENDAPATAN ASLI DAERAH (PAD) PROVINSI JAWA BARAT TAHUN 2017-2021. Sarjana thesis, Universitas Siliwangi.

APRILA, VIRA (2022) FAKTOR-FAKTOR YANG MEMPENGARUHI KEPUTUSAN PEMBELIAN PRODUK PAKAIAN SECARA ONLINE (Survey Pada Mahasiswa Program Studi Ekonomi Pembangunan Fakultas Ekonomi Dan Bisnis Universitas Siliwangi Angkatan 2018-2021). Sarjana thesis, Universitas Siliwangi.

APRILIO, ALVIN ALDINO (2020) PENGARUH BUDAYA ORGANISASI DAN KEMAMPUAN KERJA TERHADAP ORGANIZATIONAL CITIZENSHIP BEHAVIOR (Suatu penelitan terhadap karyawan bagian fashion di Mall Asia Plaza Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

ARDIAN, DENDI (2022) PENGARUH LUAS TANAM, MODAL, DAN TENAGA KERJA TERHADAP HASIL PRODUKSI JAGUNG DI KECAMATAN JATINAGARA KABUPATEN CIAMIS. Sarjana thesis, Universitas Siliwangi.

ARDIANSAH, ALDI (2020) ANALISIS HUBUNGAN KAUSALITAS ANTARA INFLASI DAN PENGANGGURAN (STUDI KASUS DI PROVINSI JAWA BARAT TAHUN 2006-2018 DENGAN PENDEKATAN KURVA PHILLIPS). Sarjana thesis, Universitas Siliwangi.

ARDIANSYAH, AYI IHSAN (2020) ANALISIS IMPLEMENTASI ETIKA BISNIS ISLAM PADA PEDAGANG DI PASAR GEGERNOONG GOBRAS KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

ARFANI, SALMA SANIA (2021) PENGARUH HUTANG JANGKA PENDEK, HUTANG JANGKA PANJANG DAN MODAL KERJA TERHADAP PROFITABILITAS PERUSAHAAN (Survey pada Perusahaan Manufaktur sub sektor Food and Beverage yang Terdaftar di Bursa Efek Indonesia Periode 2010-2019). Sarjana thesis, Universitas Siliwangi.

ARIANA, WINA (2019) PENGARUH JIWA WIRAUSAHA TERHADAP MINAT BERWIRAUSAHA PESERTA DIDIK KELAS XI SMK MITRA BATIK KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

ARIDESY, PRIHENNY (2022) PENGARUH JUMLAH PENDUDUK, TINGKAT UPAH MINIMUM REGIONAL DAN PERTUMBUHAN EKONOMI TERHADAP TINGKAT PENGANGGURAN TERBUKA KOTA TASIKMALAYA TAHUN 2009-2019. Sarjana thesis, Universitas Siliwangi.

ARIFIN, RIDWAN (2021) ANALISIS PENGELOLAAN ZAKAT DI BAZNAS KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

ARIPIN, FARID (2020) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI VOLUME EKSPOR TEMBAKAU KE BELANDA PERIODE TAHUN 2000-2015. Sarjana thesis, Universitas Siliwangi.

ARISKA, EUIS (2021) PENGARUH PENDIDIKAN KEWIRAUSAHAAN, EFIKASI DIRI, DAN KECERDASAN ADVERSITAS TERHADAP INTENSI BERWIRAUSAHA (Survey pada Peserta Didik Kelas XII SMK Negeri Rajapolah Tahun Ajaran 2021/2022). Sarjana thesis, Universitas Siliwangi.

ARISMUNANDAR, BAGUS (2021) PENGARUH MOTIVASI KERJA DAN DISIPLIN KERJA TERHADAP KINERJA PEGAWAI (Suatu Penelitian Pada Dinas Perhubungan Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

ARLIANI, NITA (2021) ANALISIS MANAJEMEN FUNDRAISING ZAKAT PROFESI DI BAZNAS KABUPATEN PANGANDARAN. Sarjana thesis, Universitas Siliwangi.

AROFAH, HILDA NAILATUL (2021) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI KAPASITAS PRODUKSI INDUSTRI SANDAL SPON DI KECAMATAN TAMANSARI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

ASHARINI, SOFIA (2020) PENGARUH TINGKAT PERDAPATAN ASLI DAERAH TERHADAP FISCAL STRESS MELALUI KEMANDIRIAN KEUANGAN DAERAH SEBAGAI VARIABEL INTERVENING (Survei pada 29 Provinsi di Indonesia Tahun 2018). Sarjana thesis, Universitas Siliwangi.

ASIYAH, INTAN NUR (2020) PENGARUH KOMUNIKASI DAN LINGKUNGAN KERJA TERHADAP EFEKTIVITAS KERJA KARYAWAN (Suatu Penelitian terhadap Pramuniaga di PT. Asia San Prima Jaya Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

ASRIADI, ADE RIZKI (2020) PENERAPAN GPN (GERBANG PEMBAYARAN NASIONAL) OLEH KANTOR PERWAKILAN BANK INDONESIA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

ASTUTI, WINI FUZI (2021) PENGARUH LITERASI EKONOMI DAN KONTROL DIRI TERHADAP PERILAKU KONSUMTIF MAHASISWA (Survey Pada Mahasiswa Fakultas Ekonomi Jurusan Ekonomi Akuntansi Universitas Siliwangi Angkatan 2017). Sarjana thesis, Universitas Siliwangi.

ASYAPITRI ANUGR, GINA (2022) PENGARUH TUNJANGAN DAN PELAYANAN TERHADAP KEPUASAN KERJA (Survei pada PNS Dinas Pekerjaan Umum dan Tata Ruang Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

ATHALLAH, GHANY AKHDAN (2021) PENGARUH KREATIVITAS DAN INOVASI TERHADAP KEUNGGULAN BERSAING (Survey pada Wedding Organizer di Wilayah Tasikmalaya dan Ciamis). Sarjana thesis, Universitas Siliwangi.

ATOILLAH, M. DZIKRI (2021) ANALISIS FAKTOR-FAKTOR YANG MENINGKATKAN MINAT NASABAH PADA BSI KCP ABDULLAH BIN NUH CIANJUR. Sarjana thesis, Universitas Siliwangi.

AUGUSTINE, MELLYNDA (2021) PENGARUH NORMA PERSONAL DAN FEAR OF FAILURE TERHADAP PROKRASTINASI AKADEMIK (Survei Pada Mahasiswa Fakultas Keguruan dan Ilmu Pendidikan Universitas Siliwangi Angkatan 2018). Sarjana thesis, Universitas Siliwangi.

AULIA DEWI, RIVANI (2019) PENERAPAN MODEL PEMBELAJARAN KOOPERATIF TIPE COOPERATIVE SCRIPT DENGAN BANTUAN MEDIA POSTER DALAM MENINGKATKAN PEMAHAMAN KONSEP (Studi Kuasi Eksperimen pada Mata Pelajaran Ekonomi Kelas X MIPA SMA Negeri 1 Sindangkasih Ciamis Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

AULIANI, AMALIA (2020) PENGARUH KOMUNIKASI DAN DISIPLIN KERJA TERHADAP SEMANGAT KERJA (Survey Pada Karyawan Non Manajerial di. PT. Sinar Sosro Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

AWABIYANTI, DESITANIA (2019) ANALISIS TINGKAT EFISIENSI PRODUKSI AYAM BROILER DI KECAMATAN DAYEUHLUHUR. Sarjana thesis, Universitas Siliwangi.

AYU, SRI NINDA (2020) PENGARUH KONFORMITAS DAN PROKRASTINASI AKADEMIK TERHADAP PRESTASI BELAJAR PESERTA DIDIK (Survey Pada Mata Pelajaran Ekonomi Peserta Didik MAN 3 Kota Tasikmalaya Tahun Ajaran 2019/2020). Sarjana thesis, Universitas Siliwangi.

AYU HARDIYANTI, INTAN (2019) ANALISIS KETIMPANGAN GENDER TERHADAP PERTUMBUHAN EKONOMI 4 PROVINSI DI PULAU JAWA TAHUN 2011-2017. Sarjana thesis, Universitas Siliwangi.

AZIS, MUHAMMAD SYAIFUL (2019) PENGARUH PRODUKSI PADI, KONSUMSI BERAS NASIONAL, INFLASI DAN NILAI TUKAR RUPIAH TERHADAP IMPOR BERAS DI INDONESIA TAHUN 2000-2017. Sarjana thesis, Universitas Siliwangi.

AZIZAH, AFIFATUL (2020) ANALISIS KINERJA KEUANGAN BAZNAS PERIODE 2014-2018. Sarjana thesis, Universitas Siliwangi.

AZIZAH, SILMI FAUZIATUL (2020) PERAN KREDIT SERTIFIKASI DALAM MENINGKATKAN KUALITAS KREDIT DI PD. BPR ARTHA SUKAPURA KOTA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

AZIZATURRAHMI, ARDISYA (2022) ANALISIS PENGARUH TENAGA KERJA, INFLASI, DAN SUKU BUNGA TERHADAP PENANAMAN MODAL DALAM NEGERI DI PROVINSI JAWA BARAT TAHUN 2006-2020. Sarjana thesis, Universitas Siliwangi.

AZZAHRA, ELMA IKLIMAH (2021) DAMPAK BANTUAN BAGI PELAKU USAHA MIKRO (BPUM) TERHADAP USAHA KONVEKSI (Studi Kasus Pada Wilayah Kecamatan Cibeureum Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

AZZAHRA, ELMA IKLIMAH (2021) DAMPAK BANTUAN BAGI PELAKU USAHA MIKRO (BPUM) TERHADAP USAHA KONVEKSI (Studi Kasus Pada Wilayah Kecamatan Cibeureum Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Adie Nugroho, Taufiq (2019) ANALISIS KINERJA CUSTOMER SERVICE DI PT. BANK BRI SYARIAH KC TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Adinda, Dewi Kamojang (2020) PENERAPAN PRINSIP 5C DALAM PEMBERIAN KREDIT PEMILIKAN RUMAH BTN PLATINUM PADA PT. BANK TABUNGAN NEGARA (PERSERO) Tbk. KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Adzdzakwan, Muhammad Habib (2021) PENGARUH SUASANA TOKO DAN CITRA MEREK TERHADAP KEPUTUSAN PEMBELIAN KONSUMEN PADA FULLHOPPER COFFEE LAB DI TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Afandi, Khoer (2022) PENGARUH KEPERCAYAAN NASABAH DAN KUALITAS LAYANAN BSI MOBILE TERHADAP KEPUASAN NASABAH DI BANK SYARIAH INDONESIA KC TASIKMALAYA SUTISNA SENJAYA. Sarjana thesis, Universitas Siliwangi.

Agung Purnomo Aji, Mohamad (2020) ANALISI FAKTOR-FAKTOR YANG MEMPENGARUHI EKSPOR UDANG DI KABUPATEN CILACAP TAHUN 2001-2018. Sarjana thesis, Universitas Siliwangi.

Agustin, Hani Vici (2021) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI EFISIENSI PADA BANK SYARIAH INDONESIA. Sarjana thesis, Universitas Siliwangi.

Agustina, Dewi (2019) ANALISIS AKAD PEMBIAYAAN MUDHARABAH PADA SEKTOR UMKM DI KSPPS MITRA INSAN MANDIRI TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Agustini, Sulistia (2020) PENGARUH KEMASAN PRODUK TERHADAP PERKEMBANGAN UMKM OLAHAN MAKANAN DENGAN HARGA JUAL SEBAGAI VARIABEL INTERVENING (Studi pada UMKM Binaan Inopak Institute di Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Agusto, Rizki (2019) ANALISIS PELAYANAN PUBLIK PADA PELAKSANAAN RETRIBUSI PD. PASAR RESIK UNIT CIKURUBUK. Sarjana thesis, Universitas Siliwangi.

Akbar, Rizky Taufik (2021) PENGARUH LOKASI, HARGA, SISTEM HOTEL SYARIAH DAN KUALITAS PELAYANAN TERHADAP KEPUTUSAN MENGINAP DI HOTEL SRIKANDI TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Alfarizi, Faiz Raka (2021) ANALISIS MANAJEMEN RISIKO PEMBIAYAAN DAN PENGELOLAAN PRODUK PPR IB MASLAHAH DI BJB SYARIAH KCP. KUNINGAN. Sarjana thesis, Universitas Siliwangi.

Alizakiya, Elda Nur (2022) PENGARUH HARGA, FITUR DAN GARANSI TERHADAP KEPUTUSAN PEMBELIAN KONSUMEN MUSLIM PADA SMARTPHONE MEREK XIAOMI DI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Almughni, Muhamad Yusuf (2021) ANALISIS LITERASI KEUANGAN SYARIAH PADA ANGGOTA KSPPS BMT BARRAH DALAM MENGGUNAKAN PRODUK PEMBIAYAAN MUDHARABAH MUTLAQOH. Sarjana thesis, Universitas Siliwangi.

Amalia, Fahira (2020) PENGARUH PENILAIAN KONSUMEN TERHADAP KEPUTUSAN PEMBELIAN DENGAN KEPERCAYAAN KONSUMEN SEBAGAI VARIABEL INTERVENING (Survei di Marketplace Shopee) SKRIPSI. Sarjana thesis, Universitas Siliwangi.

Ana Fatunnisa, Noor (2019) PERBANDINGAN MODEL PEMBELAJARAN PROBLEM BASED LEARNING DENGAN CREATIVE PROBLEM SOLVING DALAM MENINGKATKAN KEMAMPUAN BERPIKIR ANALITIS PESERTA DIDIK (Studi Quasi Eksperimen pada Mata Pelajaran Ekonomi Kelas XI IPS MA Negeri 2 Kota Tasikmalaya Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

Ananda, Rida Putri (2019) IMPLEMENTASI AKAD MUSYARAKAH MUTANAQISHAH PADA PRODUK PEMBIAYAAN KEPEMILIKAN RUMAH DI BJB SYARIAH KCP GARUT. Sarjana thesis, Universitas Siliwangi.

Andamsuri, Tasya Plaras (2022) STRATEGI PEMASARAN KREDIT PENSIUN (Pada PT. Bank Tabungan Pensiunan Nasional (BTPN) Tbk Kantor Cabang Tasikmalaya). Diploma thesis, Universitas Siliwangi.

Andrian, Safira (2020) PENGARUH ON THE JOB TRAINING DAN KOMUNIKASI TERHADAP KINERJA KARYAWAN (Suatu Penelitian Terhadap Karyawan bagian Sales Promotion di PT. Matahari Department Store Tbk cabang Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Andriani, Dina (2020) ANALISIS DAMPAK LEGALITAS DAN LABELISASI HALAL DALAM PENGEMBANGAN UMK OLAHAN MAKANAN DI KEC.CIPAKU KAB.CIAMIS. Sarjana thesis, Universitas Siliwangi.

Anggraeni, Anggi (2019) PENERAPAN MODEL PEMBELAJARAN KOOPERATIF TIPE STUDENT FACILITATOR AND EXPLAINING (SFE) TERHADAP PEMAHAMAN KONSEP PESERTA DIDIK (Studi Quasi Eksperimen pada Mata Pelajaran Ekonomi Kelas X IPS SMA Negeri 3 Tasikmalaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

Anggretya Yuniarti, Dita (2020) PROSEDUR PELAKSANAAN PEMBERIAN KREDIT BNI FLEKSI PADA PT. BANK NEGARA INDONESIA (PERSERO) Tbk. KANTOR CABANG PEMBANTU CIKURUBUK KOTA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Anggriani, Anggia Emqi (2021) PENGARUH KINERJA KEUANGAN BERBASIS VALUE FOR MONEY (EKONOMI, EFISIENSI, DAN EFEKTIVITAS) TERHADAP ALOKASI BELANJA MODAL (Sensus pada Pemerintah Provinsi di Indonesia Tahun 2015-2019). Sarjana thesis, Universitas Siliwangi.

Anisa, Ade (2019) PENGARUH PRODUKSI KEDELAI, KONSUMSI KEDELAI NASIONAL DAN IMPOR KEDELAI TAHUN SEBELUMNYA, LAJU PERTUMBUHAN EKONOMI SERTA HARGA KEDELAI DOMESTIK TERHADAP IMPOR KEDELAI DI INDONESIA TAHUN 2003-2017. Sarjana thesis, UNIVERSITAS SILIWANGI.

Anisa Maknun, Lulu (2019) PENGARUH KUALITAS PRODUK DAN KUALITAS PELAYANAN TERHADAP PREFERENSI NASABAH TABUNGAN IB MASLAHAH INSTAN DI BANK JABAR BANTEN SYARIAH KCP CIKURUBUK TASIKMALAYA. Sarjana thesis, UNIVERSITAS SILIWANGI.

Antania, Antania (2020) ANALISIS PENERIMAAN DEVISA PARIWISATA INDONESIA TAHUN 2008-2018. Sarjana thesis, Universitas Siliwangi.

Apriliasari, Tria Ajeng (2021) PENGARUH ROTASI DAN KOMPETENSI KERJA TERHADAP KINERJA KARYAWAN DI BPRS AL-MADINAH. Sarjana thesis, Universitas Siliwangi.

Ardianty, Anggita (2019) ANALISIS PENGUKURAN KUALITAS PELAYANAN BANK SYARIAH DENGAN METODE FUZZY-SERVQUAL DIMENSI CARTER (Studi Kasus pada Bank BJB Syariah Kantor Cabang Tasikmalaya). Diploma thesis, Universitas Siliwangi.

Arianti, Nurul Vita (2022) PENGARUH KEPERCAYAAN, RELIGIUSITAS DAN KEBIJAKAN PEMERINTAH TERHADAP KEPUTUSAN MEMBAYAR ZAKAT PROFESI (Studi Kasus di BAZNAS Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Ariefa, Ratu Farha (2022) ANALISIS STRATEGI PENGHIMPUNAN DANA ZAKAT, INFAK, SEDEKAH (ZIS) PADA MASA PANDEMI COVID-19 DI BAZNAS KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Arika, Deki (2019) PENERAPAN MODEL PEMBELAJARAN KOOPERATIF TIPE TEAMS GAMES TOURNAMENT DENGAN BANTUAN MEDIA TEKA-TEKI SILANG DALAM MENINGKATKAN PRESTASI BELAJAR SISWA (Studi Kuasi Eksperimen Pada Siswa Kelas XI IPS MAN 7 Kabupaten Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Arip Nurjaman, Ujang (2020) TINJAUAN AKAD IJARAH iB HASANAH CARD PADA PT. BANK BNI SYARIAH KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Aslam Fikri, Muhammad (2019) ANALISIS PENGEMBANGAN USAHA DENGAN BUSINESS MODEL CANVAS PADA STARTUP EO SAVANA PLANNER TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Atorid Mahmud, Zainal (2019) PENGARUH KEPEMIMPINAN DAN MOTIVASI TERHADAP IMPLEMENTASI STRATEGI SERTA IMPLIKASINYA TERHADAP KINERJA (Survei Pada Pegawai Perusahaan Daerah Air Minum Tirta Sukapura Kabupaten Tasikmalaya). Pascasarjana thesis, Universitas Siliwangi.

Aulia, Syenia Hilyatul (2021) FAKTOR PENENTU PRODUKSI DAN ANALISIS EFISIENSI BUDIDAYA IKAN NILA DI DESA BANGUNHARJA KECAMATAN CISAGA KABUPATEN CIAMIS. Sarjana thesis, Universitas Siliwangi.

Awaliyah, Syifatul (2020) PENGARUH LOAN TO DEPOSIT RATIO, DAN EARNING PER SHARE TERHADAP RETURN SAHAM (Pada PT. Bank Rakyat Indonesia (Persero) Tbk). Sarjana thesis, Universitas Siliwangi.

Ayuningsih, Sri (2022) MEKANISME PENYELAMATAN KREDIT MACET UMKM PADA PT BANK PEMBANGUNAN DAERAH JAWA BARAT DAN BANTEN Tbk KANTOR CABANG PEMBANTU MANONJAYA. Sarjana thesis, Universitas Siliwangi.

Azhar Hidayatullah, Mohamad (2021) PENGARUH RETURN ON ASSET (ROA), RETURN ON EQUITY (ROE), JUMLAH EMITEN DAN LAJU PERTUMBUHAN EKONOMI TERHADAP HARGA SAHAM (Studi Kasus Pada 10 Perusahaan Sektor Makanan Dan Minuman Yang Terdaftar Di BEI Tahun 2010-2019). Sarjana thesis, Universitas Siliwangi.

Aziz, Reza Subhan (2020) ANALISIS AKTIVITAS LOGISTIK PADA PENGEPUL KELINCI DI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Azizah, Rosa Nur (2021) ANALISIS FAKTOR-FAKTOR YANG MEMENGARUHI KEPUTUSAN PEMBELIAN SKINCARE ORGANIK DI KALANGAN MILENIAL (Survei pada Pengguna Skincare Organik di Jawa Barat). Sarjana thesis, Universitas Siliwangi.

Azmi, Rijal Khoerul (2021) TINJAUAN PELAKSANAAN SERVICE EXCELLENT DI PD BPR ARTHA GALUNGGUNG KOTA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Azmi Ulfaz, Muhammad (2019) PENGARUH LINGKUNGAN KELUARGA TERHADAP MOTIVASI BERWIRAUSAHA MAHASISWA PENDIDIKAN EKONOMI (Survei Pada Mahasiswa Pendidikan Ekonomi Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

A’LAWI, ARSAL (2019) PENGARUH MODAL, TENAGA KERJA DAN BAHAN BAKU TERHADAP NILAI PRODUKSI (Studi Kasus pada Industri Meubel di Kecamatan Cibeureum Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

B

BAGAS BAHARI CAHYANA, RADEN (2020) PENGARUH MOTIVASI KERJA, BUDAYA KERJA, DAN KESELAMATAN KESEHATAN KERJA (K3) TERHADAP KINERJA KARYAWAN (Survey Pada Karyawan Non Manajerial Pada PT. Lottemart Whosale Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

BAIHAQI, MUHAMMAD SHOLEH (2021) PENGARUH KUALITAS PRODUK, HARGA DAN KUALITAS PELAYANAN TERHADAP KEPUASAN PELANGGAN (Studi Kasus Di Vania Store Hijab Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

BASRI, OI NURUL (2020) ANALISIS PERMINTAAN TENAGA KERJA DI INDONESIA TAHUN 2005-2018. Sarjana thesis, Universitas Siliwangi.

BASRI, OI NURUL (2020) ANALISIS PERMINTAAN TENAGA KERJA DI INDONESIA TAHUN 2005-2018. Sarjana thesis, Universitas Siliwangi.

BERLINA, AYU (2020) PROSEDUR PENCEGAHAN FRAUD DALAM PERKREDITAN PADA BANK WOORI SAUDARA KANTOR CABANG PEMBANTU GUNUNG SABEULAH KOTA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

BUDIONO, ANTONO REZA (2021) ANALISIS FAKTOR-FAKTOR INTERNAL YANG MEMPENGARUHI HASIL BELAJAR PADA MATA PELAJARAN EKONOMI (Survei Pada Peserta Didik Kelas XII IPS SMA Negeri Se-Kota Banjar Tahun Ajaran 2021/2022). Sarjana thesis, Universitas Siliwangi.

Badruzaman, Jajang (2014) ANALISIS PERENCANAAN & PERTUMBUHAN KEUANGAN MELALUI PENDEKATAN NERACA PROFORMA. Hasil Reviewer, 9 (2). pp. 105-114. ISSN 1907 - 9958

Badruzaman, Jajang (2015) ANALYSIS COMPARATIF OF NON PERFORMANCE FINANCING BEFORE AND AFTER PUBLISHED OF FATWA NUMBER 84/DSNMUI/ XII/2012 AT SHARIA BANKING (Census Of Four Sharia Banking At Tasikmalaya). Hasil Reviewer. pp. 5-22. ISSN 978-602-1004-12-8

Badruzaman, Jajang (2019) Analysis Relative Strength Index and Earning Per Share on Stock Price. Hasil Reviewer, 12 (4). pp. 1-9. ISSN 2456-639X

Badruzaman, Jajang Analysis of Asset Growth and Profit Growth Through Supply Chain Management Toward Company Value. Korespondensi.

Badruzaman, Jajang (2019) Analysis of Comparison of Stock Prices before and After Announcement of Business-27 Indks (Census on Companies in the Category of Business Index 27 in 2018). Hasil Reviewer, 4 (7). pp. 592-595. ISSN 2415 6663 (print) ISSN 2415 6671 (online)

Badruzaman, Jajang (2019) EFFECT OF CAPITAL STRUCTURE ON RETURN ON EQUITY: A SURVEY ON ISSUERS OF CATEGORIES JII70 OF THE INDONESIA STOCK EXCHANGE. Hasil Reviewer, 5 (89). pp. 242-246. ISSN 242-246

Badruzaman, Jajang (2020) The Effect of Payout Ratio Dividend and Earning Volatility on Stock Price (In the 2014-2017 BEI Manufacturing Company). Saudi Journal of Economics and Finance, 4 (7). pp. 326-334. ISSN 2523-6S63

Badruzaman, Jajang THE IMPACT OF EARNING PER SHARE AND RETURN ON EQUITY ON STOCK PRICE. Hasil Uji Kemiripan.

Badruzaman, Jajang (2020) The Influence of Return on Equity and Price Earnings Ratio to ward Price to Book Value. Hasil Reviewer, 82. pp. 13057-13061. ISSN 0193-4120

Badruzaman, Jajang (2012) PENGARUH BUDAYA ORGANISASI DAN ORGANIZATION CITIZENSHIP BEHAVIOUR (OCB) TERHADAP KUALITAS LAYANAN (Studi kasus pada Rumah Sakit Umum Daerah Kota Tasikmalaya). Hasil Reviewer, 6 (2). pp. 66-91. ISSN 1907-9958

Badruzaman, Jajang (2014) PENGARUH DUKUNGAN PIMPINAN DAN KOMPETENSI STAF AKUNTANSI TERHADAP PENERAPAN GOOD GOVERNANCE SERTA DAMPAKNYA TERHADAP KUALITAS INFORMASI AKUNTANSI KEUAN. Hasil Reviewer, 9 (1). pp. 67-86. ISSN 1907 - 9958

Badruzaman, Jajang (2010) PENGARUH PENGAWASAN INTERN TERHADAP KINERJA KOPERASI (SENSUS PADA KUD DI KOTA TASIKMALAYA). Hasil Reviewer, 2 (1). pp. 95-114. ISSN 2058-7055

Badruzaman, Jajang (2010) Pengaruh Corporate Social Responsibility Disclosure Terhadap Pertumbuhan Perusahaan. Hasil Reviewer, 5 (2). pp. 107-117. ISSN 1907-1442

Badruzaman, Jajang (2013) Pengaruh Debt To Equity Ratio Dan Return On Equity Terhadap Earning Per Share. Hasil Reviewer, 8 (2). pp. 272-283. ISSN 1907 - 9958

Badruzaman, Jajang (2014) Pengaruh Dukungan Pimpinan Dan Kompetensi Staf Akuntansi Terhadap Penerapan Good Governance Serta Dampaknya Terhadap Kualitas Informasi Akuntansi Keuangan Daerah. Hasil Reviewer, 9 (1). pp. 67-86. ISSN 1907 - 9958

Badruzaman, Jajang (2017) Pengaruh Earning Per Share Terhadap Harga Saham. Hasil Reviewer, 12 (1). pp. 101-110. ISSN 1907 - 9958

Badruzaman, Jajang (2018) STOCK PRICE ANALYSIS BEFORE AND AFTER THE ISSUANCE OF FINANCIAL STATEMENTS: SURVEY ON BASIC AND CHEMICAL INDUSTRIES AT INDONESIA STOCK EXCHANGE. Hasil Reviewer, 8 (80). pp. 26-30. ISSN 2226-1184

Badruzaman, Jajang and Chairunnisa, Irna (2012) PENGARUH IMPLEMENTASI SISTEM AKUNTABILITAS KINERJA INSTANSI PEMERINTAH (SAKIP) TERHADAP PENERAPAN GOOD GOVERNANCE (Sensus pada 14 Dinas Daerah di Pemerintah Kabupaten Ciamis). Hasil Reviewer, 7 (1). pp. 57-70. ISSN 1907-3771

Badruzaman, Jajang and Chairunnisa, Irna (2012) Pengaruh Implementasi Sistem Akuntabilitas Kinerja Instansi Pemerintah (SAKIP) Terhadap Penerapan Good Governance. Jurnal Nasional Terakrditasi, 7 (1). pp. 57-70. ISSN 1907-3771

Badruzaman, Jajang and Kusmayadi, Dedi (2014) Akuntansi Hotel. Hasil Reviewer. pp. 1-118. ISSN 978-602-99904-7-8

Badruzaman, Jajang and Kusmayadi, Dedi (2017) Dividend payout ratio influence To wards stock price (Survey of The Firm LQ 45 Listed in Indonesian Stock Exchange). Hasil Reviewer, 23 (9). pp. 773-784. ISSN 8793-8795

Badruzaman, Jajang and Kusmayadi, Dedi (2014) Model of Good Financial Governance in Badan Amil Zakat Tasikmalaya. Hasil Reviewer. pp. 67-84. ISSN 978-979-9204-99-8

Badruzaman, Jajang and Nurleli, Leli (2013) PENGARUH INSENTIF TERHADAP PRODUKTIVITAS TENAGA KERJA DAN DAMPAKNYA PADA PROFITABILITAS PERUSAHAAN. Hasil Reviewer, 8 (1). 184 -197. ISSN 1907 - 9958

Badruzaman, Jajang and Nurleli, Leli (2013) Pengaruh Insentif terhadap Produktivitas Tenaga Kerja dan Dampaknya pada Profitabilitas Perusahaan. Jurnal Nasional, 8 (1). pp. 184-197. ISSN 1907 - 9958

Badruzaman, Jajang and Nurleli, Leli (2012) Pengaruh Insentif terhadap Produktivitas Tenaga Kerja dan Dampaknya pada Profitabilitas Perusahaan. Hasil Reviewer, 8 (1). pp. 184-197. ISSN 1907 - 9958

Badruzaman, Jajang and Pelitawati, Tita (2011) PENGARUH LINGKUNGAN KERJA TERHADAP MOTIVASI DAN KOORDINASI SERTA DAMPAKNYA TERHADAP KINERJA PEGAWAI (Sensus Terhadap Pegawai Struktural Eselon IV Pada Kantor Kelurahan dan Kecamatan Kota Tasikmalaya). Hasil Reviewer, 6 (1). pp. 675-687. ISSN 1907-9958

Badruzaman, Jajang and Ramdhani, Ridwan (2011) HUBUNGAN INVESTMENT OPPORTUNITY SET (IOS) HUBUNGAN INVESTMENT OPPORTUNITY SET (IOS) PADA HARGA SAHAM DENGAN SALES GROWTH PERUSAHAAN DI BURSA EFEK INDONESIA (Survey pada Perusahaan Manufaktur yang Listing di BEI). Hasil Reviewer, 3 (2). pp. 597-609. ISSN 2086-2563

Badruzaman, Jajang and Ridho, Adil and Saputra, Jumadil (2019) Analysis of Asset Growth and Profit Growth Through Supply Chain Management Toward Company Value. Hasil Reviewer, 8 (5). pp. 336-348. ISSN 2050-7399 (Online), 2051-3771 (Print)

Badruzaman, Jajang and Ridho, Adil and Saputra, Jumadil (2019) Analysis of Asset Growth and Profit Growth Through Supply Chain Management Toward Company Value. Hasil Reviewer, 8 (5). pp. 336-348. ISSN 2050-7399 (Online), 2051-3771 (Print)

Badruzaman, Jajang and Sugiarti, Rini (2010) PENGARUH RETURN ON INVESTMENT TERHADAP DEVIDED PAYOUT RATIO DAN DAMPAKNYA PADA VOLUME PERDAGANGAN SAHAM. Hasil Reviewer, 5 (1). pp. 392-412. ISSN 1907-9958

Bahtiar, Ade (2020) EFISIENSI PRODUKSI TERNAK AYAM PETELUR DI HC FARM KECAMATAN CIAWI KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Baihaqi, Dimas Afrizal (2020) PENGARUH STRESS KERJA TERHADAP KINERJA PEGAWAI DENGAN PENGALAMAN KERJA SEBAGAI VARIABEL MODERASI PADA BSM KANTOR CABANG TANGERANG BINTARO. Sarjana thesis, Universitas Siliwangi.

Barduzaman, Jajang (2020) Analisis Efisiensi dan Kinerja Syariah di Indonesia. JURNAL AKUNTANSI, 15 (1). pp. 20-27. ISSN 1907-9958

Belia, Erviana Mega (2022) ANALISIS KELAYAKAN NASABAH DALAM PENYALURAN PEMBIAYAAN MURABAHAH DI KSPPS BMT SAHABAT KITA SEMUA. Sarjana thesis, Universitas Siliwangi.

Brilian, Muhammad Haikal (2021) PROSEDUR PENYELESAIAN KREDIT BERMASALAH PADA KREDIT MIKRO DI PT. BANK PEMBANGUNAN DAERAH JAWA BARAT DAN BANTEN KANTOR CABANG PEMBANTU LIMBANGAN. Diploma thesis, Universitas Siliwangi.

Budiman, Ihsan (2019) PENGARUH CURRENT RATIO DAN STRUKTUR MODAL TERHADAP RETURN ON ASSET (ROA) (Survei pada Sektor Makanan dan Minuman yang Terdaftar di Bursa Efek Indonesia Tahun 2015-2017). Sarjana thesis, Universitas Siliwangi.

Bulan, Mutiara (2022) PERAN PT.BANK WOORI SAUDARA INDONESIA 1906, Tbk KCP MANONJAYA SEBAGAI MITRA BAYAR DALAM MENYALURKAN DANA PENSIUN. Diploma thesis, Universitas Siliwangi.

C

CHAERANI, NADIA (2019) PENGARUH PENDAPATAN ASLI DAERAH (PAD), DANA PERIMBANGAN DAN PENANAMAN MODAL DALAM NEGERI (PMDN) TERHADAP PRODUK DOMESTIK REGIONAL BRUTO (PDRB) DI PULAU JAWA. Sarjana thesis, Universitas Siliwangi.

CHANIAGO, AGNES JULIAN (2022) PENYERAPAN TENAGA KERJA DI PROVINSI JAWA BARAT: BUKTI EMPIRIS FAKTOR-FAKTOR YANG MEMPENGARUHINYA. Sarjana thesis, Universitas Siliwangi.

CINDYAFIA, ANNISA (2020) PENGARUH IKLAN MELALUI INSTAGRAM STORIES ADS TERHADAP KEPUTUSAN PEMBELIAN PADA PENGGUNA ONLINE SHOP FASHION. Sarjana thesis, Universitas Siliwangi.

CLARA TAMI, RINDA (2017) PENGARUH PAJAK DAERAH DAN RETRIBUSI DAERAH TERHADAP PENDAPATAN ASLI DAERAH (Studi Kasus Pada Pemerintah Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Cahya Lestari, Vita (2021) PENGARUH PENDIDIKAN KEWIRAUSAHAAN, LOCUS OF CONTROL DAN SELF EFFICACY TERHADAP NIAT BERWIRAUSAHA MAHASISWA. Sarjana thesis, Universitas Siliwangi.

Cahyadi, Redi (2021) PENGARUH DIVIDEND PAYOUT RATIO, DEBT TO EQUITY RATIO, DAN RETURN ON ASSETS TERHADAP HARGA SAHAM (Survey pada Sektor Perbankan Bursa Efek Indonesia) Periode 2014 – 2018. Pascasarjana thesis, Universitas Siliwangi.

Chika Nuroktaviani, Cucu (2019) PENERAPAN MODEL PEMBELAJARAN TREFFINGER DENGAN BANTUAN MEDIA POWER POINT DALAM MENINGKATKAN KEMAMPUAN BERPIKIR KREATIF SISWA (Studi Kuasi Eksperimen Pada Siswa Kelas XI IPS Pada Mata Pelajaran Prakarya/Kewirausahaan di SMA Negeri 1 Kota Tasikmalaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

D

DAFFA ROBIANI, ANNISA (2020) TINJAUAN PELAKSANAAN PROMOSI KREDIT UMUM PENSIUNAN (KUPEN) PADA PT. BANK WOORI SAUDARA INDONESIA 1906, Tbk. KANTOR CABANG PEMBANTU (KCP) MANONJAYA. Diploma thesis, Universitas Siliwangi.

DALINA, LINDA (2022) PENGARUH INFLASI, NILAI TUKAR DAN PENDAPATAN PERKAPITA TERHADAP IMPOR DARI CINA PERIODE 2004-2018. Sarjana thesis, Universitas Siliwangi.

DAMAYANTI, KIKI (2019) PENGARUH STATUS SOSIAL EKONOMI ORANG TUA DAN TEMAN SEBAYA TERHADAP GAYA HIDUP HEDONISME MAHASISWA (Survei Pada Mahasiswa Jurusan Pendidikan Ekonomi Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

DAMAYANTI, SISKA (2022) ANALISIS KINERJA EKONOMI MAKRO TERHADAP PENGANGGURAN DI INDONESIA TAHUN 2011 – 2020 (Studi Kasus di 34 Provinsi Seluruh Indonesia). Sarjana thesis, Universitas Siliwangi.

DARMAWAN, ADI (2019) PENGARUH KUALITAS KEHIDUPAN KERJA DAN PENGEMBANGAN KARIER TERHADAP KINERJA KARYAWAN (Penelitian Pada Staff Di PT. PLN (Persero) Area Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

DARMAYANTI, NINA (2022) STRATEGI PROMOSI PROGRAM BOOSTER AKUISISI DALAM UPAYA PENINGKATAN JUMLAH NASABAH EMERALD PADA PT BANK NEGARA INDONESIA (Persero) KANTOR CABANG PEMBANTU PANGANDARAN. Diploma thesis, Universitas Siliwangi.

DELIA, RISNA (2021) “PENGARUH KECERDASAN EMOSIONAL, MOTIVASI BELAJAR, DAN SELF EFFICACY TERHADAP KEMAMPUAN BERPIKIR KRITIS SISWA PADA MATA PELAJARAN EKONOMI”. Sarjana thesis, Universitas Siliwangi.

DERAJAT, MUHAMAD GIAN (2021) PENGARUH PROMOSI JABATAN, INSENTIF, DAN LINGKUNGAN KERJA TERHADAP KEPUASAN KERJA (Suatu Penelitian Pada Karyawan Bagian Produksi CV. Al-Zidan Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

DIANI, ASFIA TIARA (2021) PENGARUH PEMBELAJARAN JARAK JAUH (PJJ DARING) MASA PANDEMI COVID 19 TERHADAP KEMANDIRIAN DAN MOTIVASI SISWA (Penelitian Survey Pada Peserta di kelas XII SMA 8 Tasikmalaya Pada Mata pelajaran Ekonomi). Sarjana thesis, Universitas Siliwangi.

DIANNINGSIH, EVA (2021) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI KEPUTUSAN PEMBELIAN KONSUMEN MUSLIM PADA MARKETPLACE SHOPEE. Sarjana thesis, Universitas Siliwangi.

DWI ASTIANI, NIDYA (2018) PENERAPAN MODEL PEMBELAJARAN CREATIVE PROBLEM SOLVING (CPS) UNTUK MENINGKATKAN KEMAMPUAN BERPIKIR KREATIF PESERTA DIDIK PADA MATA PELAJARAN EKONOMI (Studi Quasi Eksperimen Pada Mata Pelajaran Ekonomi Kelas XI SMA Negeri 4 Tasikmalaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

DWI RAHMAWATI, NINDI (2019) PENGARUH LINGKUNGAN KELUARGA DAN LINGKUNGAN MASYARAKAT TERHADAP PRESTASI BELAJAR (Survei Pada Mata Pelajaran Ekonomi Siswa Kelas XI IPS SMA Negeri 1 Cihaurbeuti). Sarjana thesis, Universitas Siliwangi.

DWILESTARI, TRESNA AYU (2021) PENGARUH FIRM SIZE, LIKUIDITAS, LEVERAGE, DAN PROFITABILITAS TERHADAP FINANCIAL DISTRESS (Survei pada Perusahaan Manufaktur yang Terdaftar di BEI Periode 2015-2020). Sarjana thesis, Universitas Siliwangi.

DWIPUTRA, AKBAR (2020) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI TINGKAT PENGANGGURAN TERBUKA DI PROVINSI JAWA BARAT TAHUN 2006-2017. Sarjana thesis, Universitas Siliwangi.

DWIPUTRA, FACHRUL SEPTIAN (2019) PENGARUH KUALITAS PRODUK, LOKASI DAN PROMOSI TERHADAP LOYALITAS PELANGGAN (Penelitian Pada Dya Bordir Kawalu Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Darusalam, Nida Aliifa (2021) ANALISIS EFEKTIVITAS PENDAYAGUNAAN DANA ZAKAT PADA PROGRAM UMAT MANDIRI DI PZU KLP CIPEDES. Sarjana thesis, Universitas Siliwangi.

Delvira, Elga Yulia (2021) ANALISIS STRATEGI PEMASARAN SYARIAH PEMBIAYAAN MURABAHAH PADA PRODUK CICIL EMAS DALAM MENINGKATKAN JUMLAH NASABAH (Studi Kasus Bank Syariah Indonesia KCP Moh. Toha Bandung). Sarjana thesis, Universitas Siliwangi.

Delvira, Elga Yulia (2021) ANALISIS STRATEGI PEMASARAN SYARIAH PEMBIAYAAN MURABAHAH PADA PRODUK CICIL EMAS DALAM MENINGKATKAN JUMLAH NASABAH (Studi Kasus Bank Syariah Indonesia KCP Moh. Toha Bandung). Sarjana thesis, Universitas Siliwangi.

Deris, Margana (2019) PENGARUH LINGKUNGAN SEKOLAH DAN LINGKUNGAN KELUARGA TERHADAP DISIPLIN BELAJAR PESERTA DIDIK (Penelitian Survei Terhadap Peserta Didik Kelas XI SMA Negeri 8 Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Dewi, Ayuni (2020) ANALISIS DAMPAK KOMPENSASI DAN MOTIVASI KERJA DALAM MENINGKATKAN KINERJA KARYAWAN DI BMT AL-HIDAYAH KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Dewi, Nuryani (2021) PENGARUH TENAGA KERJA DAN MODAL TERHADAP PRODUKSI (Studi Kasus Industri Mukena di Desa Cibatuireng ). Sarjana thesis, Universitas Siliwangi.

Dian Rizqi Muzaqqi, Muhammad (2019) ANALISIS EFEKTIVITAS PROGRAM FUNDRAISING PADA GERAI PELAYANAN ZAKAT DI DAARUT TAUHIID PEDULI PRIANGAN TIMUR. Sarjana thesis, Universitas Siliwangi.

Dinahastuti, Dini and Badruzaman, Jajang and -, Wursan (2019) Effect of Capital Asset Pricing Model on Stock Prices. Hasil Uji Kemiripan, 13 (3). pp. 1-11. ISSN 2456-639X

E

EKA SEPTIAWATI, HERLIS (2020) SISTEM DAN PROSEDUR TABUNGAN PERENCANAAN MASA DEPAN (TAPENAS) PADA PT. BANK NEGARA INDONESIA (PERSERO) Tbk. KANTOR CABANG PEMBANTU UNIVERSITAS SILIWANGI. Diploma thesis, Universitas Siliwangi.

ELI LIFARAWATI, ARVIYANA (2019) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI KEPUTUSAN PEMBELIAN SECARA ONLINE PADA MAHASISWA PENDIDIKAN EKONOMI UNIVERSITAS SILIWANGI (Studi Kasus Konsumen Online pada Mahasiswa Pendidikan Ekonomi 2015-2018). Sarjana thesis, universitas siliwangi.

ELIZA, FERTIKA (2022) PENGARUH LABEL HALAL, BRAND IMAGE, DAN KELOMPOK REFERENSI TERHADAP KEPUTUSAN PEMBELIAN KONSUMEN MUSLIM PADA PRODUK SKINCARE DI MARKETPLACE SHOPEE. Sarjana thesis, Universitas Siliwangi.

ENDRIYANA, ENDRIYANA (2019) PROSEDUR LAYANAN CUSTOMER SERVICE DALAM PENGADUAN PRODUK TABUNGAN PADA PT. BANK TABUNGAN PENSIUNAN NEGARA KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Ersa, Suscia (2022) FAKTOR-FAKTOR YANG MEMPENGARUHI iiWANPRESTASI iiDEBITUR iiBANK NEGARA INDONESIA iiKANTOR CABANG PEMBANTU iiPANGANDARAN. Diploma thesis, Universitas Siliwangi.

Evitania, Ai (2022) ANALISIS DETERMINASI PENYALURAN KREDIT UMKM OLEH BANK UMUM DI INDONESIA TAHUN 2011-2021. Sarjana thesis, Universitas Siliwangi.

F

F, Muhammad Ikhsan (2020) ANALISIS STRATEGI FUNDRAISING WAKAF DENGAN CROWDFUNDING DONATION BASED PADA PROGRAM WAKAF KOMPLEK RS SALMAN HOSPITAL DI BADAN WAKAF SALMAN ITB. Sarjana thesis, Universitas Siliwangi.

FACHRIJAL, MAULANA FAJAR (2019) PENGARUH PRODUK HARGA DAN PROMOSI TERHADAP KEPUTUSAN PEMBELIAN (Survey Pada Konsumen CV. Aksepindo Pratama Jakarta Pusat). Pascasarjana thesis, Universitas Siliwangi.

FADILA, DESVIRA TRI (2020) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI PENYERAPAN TENAGA KERJA DI INDONESIA TAHUN 2004-2018. Sarjana thesis, Universitas Siliwangi.

FADILAH, JIHAN (2021) PENGARUH HARGA, LABELISASI HALAL, KUALITAS PRODUK, DAN BRAND TRUST TERHADAP LOYALITAS PELANGGAN (Studi Kasus pada Konsumen PIXY di Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

FADILAH, NUR AZIZ (2021) PENGARUH DAYA BELI, VARIASI PRODUK, LOKASI DAN HARGA TERHADAP KEPUTUSAN PEMBELIAN TANAMAN HIAS ( Survei Pada Konsumen Tanaman Hias di Kumber Farm Jl. K.H. Ruhiat, Kp. Leuwitugu No 21, RT.03 / RW.08, Desa. Cipakat, Kec. Singaparna, Kab. Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

FADILLA NPM., ZULVAN NUR MUHAMMAD (2020) ANALISIS BESARAN YANG MEMPENGARUHI PERTUMBUHAN EKONOMI DI JAWA BARAT 2009 - 2018. Sarjana thesis, Universitas Siliwangi.

FADILLAH, MUHAMMAD FACHRUL (2020) PENGARUH SALES PROMOTION DAN ADVERTISING TERHADAP KEPUTUSAN IMPULSE BUYING PADA ONLINE SHOP SHOPEE. Sarjana thesis, Universitas Siliwangi.

FAHMI, WANDARA (2019) PENGARUH PENDIDIKAN, PENGANGGURAN, DAN PERTUMBUHAN EKONOMI TERHADAP TINGKAT KEMISKINAN DI INDONESIA TAHUN 2004-2018. Sarjana thesis, Universitas Siliwangi.

FAJAR, IQBAL NUR (2022) PENGARUH RASIO SOLVABILITAS DAN RASIO PROFITABILITAS TERHADAP VALUASI PERUSAHAAN DENGAN METODE DIVIDEND DISCOUNT MODEL (Survei Perusahaan yang Terdaftar pada Indeks Saham Syariah Indonesia (ISSI) di Bursa Efek Indonesia (BEI) pada Tahun 2016-2020). Sarjana thesis, Universitas Siliwangi.

FAJRIEN, FUJI UTAMI (2020) PENGARUH NILAI TUKAR, PRODUK DOMESTIK BRUTO (PDB), INVESTASI ASING LANGSUNG TERHADAP NERACA PERDAGANGAN INDONESIA DENGAN EMPAT MITRA DAGANG TAHUN 2004 - 2018. Sarjana thesis, Universitas Siliwangi.

FARIDA, FEMY GINA (2022) PROSEDUR DIGITAL OPENING ACCOUNT (DOA) TAPLUS MUDA PADA BNI MOBILE BANKING PT BANK NEGARA INDONESIA (Persero) TBK KANTOR KANTOR KAS SUTISNA SENJAYA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

FARIDA, RIDA NUR (2021) PENGARUH PENDIDIKAN KEWIRAUSAHAAN, LINGKUNGAN KELUARGA DAN KEPERCAYAAN DIRI TERHADAP KESIAPAN BERWIRAUSAHA (Survei pada Siswa/i kelas XII SMK Singaparna Tahun Ajaran 2019/2020). Sarjana thesis, Universitas Siliwangi.

FARIDAH, SHOFA (2020) PENGARUH GROWTH OPPORTUNITY, CASH CONVERSION CYCLE DAN LEVERAGE TERHADAP CASH HOLDING (Studi Pada PT. Indocement Tunggal Prakarsa, Tbk). Sarjana thesis, Universitas Siliwangi.

FASYA, SAIDAH (2022) PENGARUH TABUNGAN WADIAH DAN DEPOSITO MUDHARABAH TERHADAP PROFITABILITAS DENGAN PEMBIAYAAN BAGI HASIL SEBAGAI VARIABEL INTERVENING (Studi Kasus Pada Bank Umum Syariah di Indonesia Periode 2013-2020). Sarjana thesis, Universitas Siliwangi.

FATHIYYAH NURJANAH, MITA (2021) ANALISIS CAPAIAN PROGRAM KERJA PEMBANGUNAN DESA DI KECAMATAN JAMANIS TAHUN 2015-2019. Sarjana thesis, Universitas Siliwangi.

FATIMAH, PENTI SITI (2020) ANALISIS PRODUK TABUNGAN PENDIDIKAN DI BMT IDRISIYYAH CISAYONG TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

FATIMAH, TITIN SITI (2019) ANALISIS MANAJEMEN WAKAF PRODUKTIFDALAM PEMBERDAYAAN TANAH WAKAF DI PONDOK PESANTREN RIYADLUL ULUM WADDAWAH KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

FAUJIAH, FUJA (2019) PENERAPAN MODEL PEMBELAJARAN KOOPERATIF TIPE TWO STAY TWO STRAY UNTUK MENINGKATKAN HASIL BELAJAR SISWA (Studi Eksperimen Pada Mata Pelajaran Ekonomi Kelas XI IPS SMAN 1 Cihaurbeuti Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

FAUZAN, HILMI (2020) PENGARUH KOMUNIKASI MOTIVASI DAN LINGKUNGAN KERJA TERHADAP KINERJA KARYAWAN (Suatu Penelitian Pada Karyawan Non Manajer Di PT. Asia Toserba Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

FAUZAN, IHSAN HAIRUL (2022) PENGARUH PENERAPAN SUPPLY CHAIN MANAGEMENT TERHADAP KINERJA PERUSAHAAN MELALUI KEUNGGULAN KOMPETITIF (Penelitian pada Industri Bata Merah di Wilayah Kecamatan Cisayong Kabupaten Tasikmalaya. Sarjana thesis, Universitas Siliwangi.

FAUZI, ARLI MUHAMMAD (2022) PENGARUH PRICE EARNING RATIO, PRICE TO BOOK VALUE DAN EARNING PER SHARE TERHADAP RETURN SAHAM (Studi pada PT. Media Nusantara Citra Tbk.). Sarjana thesis, Universitas Siliwangi.

FAUZI, DEDE (2020) PENGARUH PELAYANAN PRIMA TERHADAP LOYALITAS ANGGOTA DENGAN KEPUASAN SEBAGAI VARIABEL MODERATOR ( Studi Kasus : KSPPS BMT Al-Ittihad Kota Tasikmalaya ). Sarjana thesis, Universitas Siliwangi.

FAUZI, DENI (2020) Pengaruh Kelengkapan Produk, Harga dan Periklanan Terhadap Kepuasan Konsumen (Penelitian di Gudang Cell Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

FAUZI, IZHAR ACHMAD (2020) ANALISIS FAKTOR – FAKTOR YANG MEMPENGARUHI IMPOR MIGAS INDONESIA PERIODE TAHUN 2005-2018. Sarjana thesis, Universitas Siliwangi.

FAUZI, RESY RESTIA (2021) PENGARUH PERPUTARAN MODAL KERJA DAN CURRENT RATIO (CR) TERHADAP RETURN ON ASSETS (ROA) PADA PT. AKASHA WIRA INTERNATIONAL, Tbk. Sarjana thesis, Universitas Siliwangi.

FAUZI IDRIS, EZZA (2019) ANALISIS PENYERAPAN TENAGA KERJA PADA INDUSTRI PAVING BLOCK DI KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

FAUZIAH, DIAH (2020) ANALISIS PENERAPAN DESAIN PROSES UNTUK MEMINIMUMKAN WAKTU PRODUKSI PAYUNG GEULIS DI CV. KINANTI SAKTI. Sarjana thesis, Universitas Siliwangi.

FAUZIAH, HAFITA (2020) ANALISIS INVESTASI ASING LANGSUNG DI NEGARA-NEGARA ASEAN TAHUN 2008-2018. Sarjana thesis, Universitas Siliwangi.

FAUZIAH, HAFITA (2020) ANALISIS INVESTASI ASING LANGSUNG DI NEGARA-NEGARA ASEAN TAHUN 2008-2018. Sarjana thesis, Universitas Siliwangi.

FAUZIAH, KANIDA (2022) PENGARUH REGIONAL SPILLOVER EFFECT TERHADAP PEMBANGUNAN EKONOMI KABUPATEN/ KOTA DI JAWA BARAT. Sarjana thesis, Universitas Siliwangi.

FAUZIAH, ULFA (2018) PENGARUH LINGKUNGAN SEKOLAH DAN KETERAMPILAN MENGAJAR GURU TERHADAP MINAT BELAJAR SISWA PADA MATA PELAJARAN EKONOMI DI KELAS IPS SMA TERPADU RIYADLUL ULUM. Sarjana thesis, Universitas Siliwangi.

FAZA, NUDIYA SILMI (2020) PENGARUH DEBT COVENANT, RISIKO LITIGASI, DAN GROWTH OPPORTUNITIES TERHADAP ACCOUNTING CONSERVATISM (Survei Pada Perusahaan yang Terdaftar di Indeks LQ45 Bursa Efek Indonesia Periode 2013-2018). Sarjana thesis, Universitas Siliwangi.

FEBBY FATHUR RACHMAN, MUHAMMAD (2019) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI KEUNTUNGAN PERUSAHAAN MEBEL (STUDI KASUS DI KECAMATAN TAWANG KOTA TASIKMALAYA TAHUN 2019). Sarjana thesis, Universitas Siliwangi.

FEBBYRIANTI, VIMPI SILVIE (2019) PROSEDUR PENANGANAN PEMBIAYAAN BERMASALAH PRODUK KPR SEJAHTERA iB PT. BANK TABUNGAN NEGARA (Persero) Tbk. KANTOR CABANG SYARIAH TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

FEBBYRIANTI, VIMPI SILVIE (2020) PROSEDUR PENANGANAN PEMBIAYAAN BERMASALAH PRODUK KPR SEJAHTERA iB PT. BANK TABUNGAN NEGARA (Persero) Tbk. KANTOR CABANG SYARIAH TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

FEBRIANI, AVNI SITI (2020) PENGARUH INDEKS PEMBANGUNAN MANUSIA, PRODUK DOMESTIK REGIONAL BRUTO DAN INFLASI TERHADAP TINGKAT PENGANGGURAN TERBUKA DI PROVINSI JAWA BARAT PERIODE TAHUN 2005-2019. Sarjana thesis, Universitas Siliwangi.

FEBRIANI, RIFA (2019) PERBANDINGAN PENGGUNAAN MEDIA PEMBELAJARAN KOMIK DAN POSTER DENGAN MODEL PEMBELAJARAN PROBLEM BASED LEARNING TERHADAP HASIL BELAJAR (Studi Quasi Eksperimen Peserta Didik pada Mata Pelajaran Ekonomi Kelas XI IPS di SMA Negeri 1 Sindangkasih). Sarjana thesis, Universitas Siliwangi.

FEBRIANI, RISSA (2020) PENGARUH RETURN ON ASSETS (ROA) DAN KURS TERHADAP RETURN SAHAM (Survey Pada Perusahaan Subsektor Food and Baverages di Bursa Efek Indonesia Tahun 2013-2018). Sarjana thesis, Universitas Siliwangi.

FEBRIYANTI, MONA (2020) PENGARUH PERSISTENSI LABA DAN DEFAULT RISK TERHADAP KOEFISIEN RESPON LABA (Survei pada Perusahaan Sektor Healthcare yang Terdaftar di Bursa Efek Indonesia dan Hong Kong Stock Exchange Tahun 2016-2018). Sarjana thesis, Universitas Siliwangi.

FIDIAKHURI, MAOLY (2019) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI NILAI PRODUKSI INDUSTRI TAHU (Studi Kasus Kecamatan Anjatan Kabupaten Indramayu). Sarjana thesis, Universitas Siliwangi.

FIKRI, ZAELANI (2019) PENGARUH KUALITAS PRODUK DAN HARGA TERHADAP KEPUTUSAN PEMBELIAN FASHION MUSLIM ONLINE (Survey Pada Mahasiswa Fakultas Agama Islam Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

FIL’ARDHIEN, KISTIE (2020) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI HASIL PRODUKSI (Studi Kasus Industri Tape Ketan di Kecamatan Cibeureum Kabupaten Kuningan). Sarjana thesis, Universitas Siliwangi.

FIRDAUS, FIRMAN MUHAMAD (2019) PENGARUH CURRENT RATIO, DEBT TO EQUITY RATIO, DAN RECEIVABLE TURN OVER TERHADAP RETURN ON ASSET PADA PT. KIMIA FARMA, TBK. Sarjana thesis, Universitas Siliwangi.

FIRDAUS, ZULFIAN (2018) PENGARUH MOTIVASI DAN MINAT BELAJAR TERHADAP HASIL BELAJAR SISWA SMP NEGERI 8 KOTA TASIKMALAYA (Penelitian Survei terhadap Siswa Kelas VIII Tahun Pelajaran 2017/2018 di SMP Negeri 8 Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

FIRMANSYAH, FIQRI (2019) PENGARUH KEMANDIRIAN KEUANGAN DAERAH DAN EFEKTIFITAS PENDAPATAN ASLI DAERAH (PAD) TERHADAP ALOKASI BELANJA MODAL (Survey Pada 6 (enam) Daerah Kabupaten/Kota Periangan Timur pada Tahun 2008-2017). Sarjana thesis, Universitas Siliwangi.

FIRNANDA, IQBAL (2021) ANALISIS KINERJA SISTEM RANTAI PASOKAN MENGGUNAKAN METODE SUPPLY CHAIN OPERATION REFERENCE (Kasus Pada PT. Marhamah Mandiri Jaya di Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

FISESAH, HERDIS (2015) PENGARUH CUSTOMER SERVICE, RESPONSIVENESS DAN EMPATHY TERHADAP KEPUASAN PENGUNJUNG HOTEL KRISNA BEACH PANGANDARAN. Sarjana thesis, Universitas Siliwangi.

FITRIA, IRMA (2022) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI INVESTASI ASING LANGSUNG DI INDONESIA TAHUN 2010-2020. Sarjana thesis, Universitas Siliwangi.

FITRIANA, INDRA (2022) MEKANISME PEMBUKAAN DAN PENUTUPAN NOMOR POKOK WAJIB PAJAK WAJIB PAJAK PERUSAHAAN SECARA ELEKTRONIK DAN MANUAL PADA KANTOR PELAYANAN PAJAK PRATAMA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

FITRIANI, ELLY (2020) ANALISIS BAURAN PROMOSI PRODUK TABUNGAN EMAS DI PEGADAIAN SYARIAH CPS PADAYUNGAN KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

FITRIANI, LELA (2021) PENGARUH DANA ALOKASI UMUM DAN DANA ALOKASI KHUSUS TERHADAP PEMBANGUNAN MANUSIA (Survey pada Pemerintahan Kabupaten/Kota di Provinsi Jawa Barat Tahun 2014-2019). Sarjana thesis, Universitas Siliwangi.

FITRIANI, RESA (2021) ANALISIS ETIKA BISNIS ISLAM PADA TOKO MEDIRA TOYS GUNUNG KALONG KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

FITRIYANA, HANA (2021) ANALISIS PENERIMAAN PAJAK BUMI DAN BANGUNAN (PBB) DI INDONESIA PERIODE 2010-2019. Sarjana thesis, Universitas Siliwangi.

FITRIYANI, NUR (2021) PENGARUH KONFLIK PERAN GANDA, IKLIM ORGANISASI, DAN KESEIMBANGAN KEHIDUPAN KERJA TERHADAP KEPUASAN KERJA (Survey pada Pegawai Perempuan PNS di Dinas Kabupaten Ciamis). Pascasarjana thesis, Universitas Siliwangi.

FRISELA, PINGKA (2021) PENGARUH PENANAMAN MODAL DALAM NEGERI, PENANAMAN MODAL ASING, PENDIDIKAN DAN BI RATE TERHADAP TINGKAT PENGANGGURAN DI INDONESIA TAHUN 2016-2019. Sarjana thesis, Universitas Siliwangi.

FRISNAWATI, EUIS (2022) ANALISIS DETERMINAN UTANG LUAR NEGERI DI INDONESIA PERIODE TAHUN 2006 – 2020. Sarjana thesis, Universitas Siliwangi.

FUAD, ANFA MAFTUHUL (2021) PENGARUH STATUS SOSIAL EKONOMI ORANG TUA, LINGKUNGAN SEKOLAH DAN SELF-EFFICACY TERHADAP MOTIVASI BELAJAR PESERTA DIDIK (Survei Pada Mata Pelajaran Ekonomi Kelas XI IPS MAN 2 Kota Tasikmalaya Tahun Ajaran 2019/2020). Sarjana thesis, Universitas Siliwangi.

FUJI HENDRIANI, SANITA (2018) PENERAPAN MODEL PEMBELAJARAN KOOPERATIF TIPE THINK PAIR AND SHARE (TPS) DENGAN ALAT BANTU MEDIA PETA KONSEP DALAM MENINGKATKAN HASIL BELAJAR SISWA ( Studi Quasi Eksperimen Pada Mata Pelajaran Ekonomi Kelas X-MIA MA Negeri 1 Tasikmalaya Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

Fadil Nurpuadi, Ahmad (2018) PENERAPAN MODEL PEMBELAJARAN GUIDED INQUIRY DALAM MENINGKATKAN KEMAMPUAN BERPIKIR KRITIS SISWA (Studi Kuasi Eksperimen pada Mata Pelajaran Ekonomi Kelas XI IPS SMA Negeri 4 Tasikmalaya Tahun Pelajaran 2017/2018). Sarjana thesis, Universitas Siliwangi.

Farhani, Fatia (2022) ANALISIS IMPLEMENTASI ETIKA BISNIS ISLAM DALAM TRANSAKSI JUAL BELI PADA PEDAGANG PASAR TRADISIONAL CIKURUBUK KECAMATAN MANGKUBUMI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Fathurohman, Cecep Maman (2020) KUALITAS PELAYANAN, KREASI NILAI DAN KEPERCAYAAN MEREK SEBAGAI FAKTOR DETERMINAN KEPUASAN (Kasus pada Pelanggan IndiHome di PT Telkom Akses Tasikmalaya). Pascasarjana thesis, Universitas Siliwangi.

Fauzi, Reza Rachmat (2020) PENGARUH EFISIENSI PERUSAHAAN (BOPO) DAN DEVIDEND PER SHARE (DPS) TERHADAP HARGA SAHAM ( Studi Kasus Bank BUMN yang Listing di Bursa Efek Indonesia). Sarjana thesis, Universitas Siliwangi.

Fauziah, Hilda (2019) PENGARUH KEMASAN DAN KUALITAS PRODUK TERHADAP DAUR HIDUP PRODUK MAKANAN OLAHAN DI MAMBO KULINER NITE KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Fauziah, Wulan (2020) ANALISIS STRATEGI DISTRIBUSI DALAM MEMPERTAHANKAN SIKLUS DAUR HIDUP PRODUK DI ASHIFA COLLECTIONS TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Fauziyah, Neng Ulfa (2020) PENGARUH GAYA HIDUP (LIFESTYLE), POLA KONSUMSI ISLAMI, DAN PROMOSI PENJUALAN (SALES PROMOTION) TERHADAP PERILAKU PEMBELIAN IMPULSIF. Sarjana thesis, Universitas Siliwangi.

Fauzy, Ekki Akbar (2019) PENGARUH INVESTASI, TINGKAT UPAH, JUMLAH UNIT USAHA, DAN JUMLAH PENDUDUK USIA PRODUKTIF TERHADAP PENYERAPAN TENAGA KERJA PADA INDUSTRI KECIL DI KOTA BANJAR TAHUN 2007-2018. Sarjana thesis, Universitas Siliwangi.

Fawwaz, Muhammad Alwan (2022) ANALISIS STRATEGI PENDAYAGUNAAN DANA ZAKAT, INFAK DAN SEDEKAH PADA PROGRAM UMAT PINTAR PZU PERSIS KLP CIPEDES KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Febiani, Dilla Firly (2022) KUALITAS PELAYANAN CUSTOMER SERVICE PADA PD BANK PERKREDITAN RAKYAT (BPR) ARTHA GALUNGGUNG KANTOR PUSAT KOTA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Febriana, Ananda (2021) ANALISIS STRATEGI EFISIENSI BJB SYARIAH KC TASIKMALAYA DALAM MASA PANDEMI COVID-19. Sarjana thesis, Universitas Siliwangi.

Febriyanti, Dila (2020) ANALISIS FAKTOR – FAKTOR YANG MEMPENGARUHI PERTUMBUHAN EKONOMI DI INDONESIA TAHUN 2001 – 2019. Sarjana thesis, Universitas Siliwangi.

Firmansyah, Irman and Marlina, Lina and Nasrulloh, Agus Ahmad (2015) Model Pengembangan Wirausaha Kreatif Berbasis Syariah di Kota Tasikmalaya Melalui Pendekatan Metode ANP (Prosiding Seminar Nasional seri ke-5 Menuju Masyarakat Madani dan Lestari. Prosiding Seminar Nasional seri ke-5 Menuju Masyarakat Madani dan Lestari, Direktorat Penelitian dan Pengabdian Masyarakat Universitas Islam Indonesia. pp. 113-130.

Fitria, Puspita Ayu (2022) PROSEDUR PENYALURAN TAKE OVER KREDIT PURNA BHAKTI (PENSIUNAN) PADA PT. BANK PEMBANGUNAN DAERAH JAWA BARAT DAN BANTEN (PERSERO) KANTOR CABANG PEMBANTU PEMKOT TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Fitrianda, Linda (2020) ANALISIS FAKTOR PRODUKSI ANYAMAN PANDAN DI RAJAPOLAH (Studi Kasus Pada Usaha Kerajinan Anyaman Pandan Di Kecamatan Rajapolah). Sarjana thesis, Universitas Siliwangi.

Fitriani, Elmalia Nurul (2021) STRATEGI PEMASARAN PRODUK TABUNGAN DI PT.BANK TABUNGAN NEGARA KANTOR KAS PADAYUNGAN TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Fitriyanti, Mutiya (2021) PENGARUH LINGKUNGAN KERJA DAN INSENTIF TERHADAP SEMANGAT KERJA PADA PRAMUNIAGA TETAP MALL ASIA PLAZA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Fradila, Dila (2021) ANALISIS PENERAPAN PRINSIP-PRINSIP GOOD CORPORATE GOVERNANCE PADA KSPPS MITRA INSAN MANDIRI TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Furwaningsih, Fauziah (2018) PENGARUH LINGKUNGAN SOSIAL SEKOLAH TERHADAP MOTIVASI BELAJAR SISWA PADA MATA PELAJARAN EKONOMI (Survey pada Siswa-siswi IPS SMA Negeri 7 Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

G

GANTINA, SRI (2020) PENGARUH TINGKAT PEMBIAYAAN JUAL BELI DAN PEMBIAYAAN BAGI HASIL TERHADAP PROFITABILITAS BANK UMUM SYARIAH (Studi Kasus pada Bank Muamalat Indonesia periode 2007-2018 yang terdaftar di Otoritas Jasa Keuangan. Sarjana thesis, Universitas Siliwangi.

GARINI, TENNY ARDIYA (2020) PENGARUH KESELAMATAN KERJA, KESEHATAN KERJA DAN LINGKUNGAN KERJA TERHADAP KINERJA KARYAWAN (Suatu Penelitian Pada Karyawan Bagian Produksi PT. Bineatama Kayone Lestari Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

GENTIKA, RINDA MARSHITA (2018) HUBUNGAN ANTARA LINGKUNGAN KELUARGA DAN MINAT BELAJAR SISWA DENGAN PRESTASI BELAJAR MATA PELAJARAN EKONOMI (Survey di Kelas XI SMA Negeri 3 Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

GHINAWATI, AULIA DWI (2020) STAREGI PENYELESAIAN KREDIT MACET DI PD. BPR ARTHA SUKAPURA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

GILANG PUSPITASARI, ADE (2019) ANALISIS PERBANDINGAN KINERJA KEUANGAN PERUSAHAAN SEBELUM DAN SESUDAH MERGER DAN AKUISISI PADA PT. XL AXIATA, TBK. PERIODE 2011-2017. Sarjana thesis, Universitas Siliwangi.

GINANJAR, DIKY (2020) ANALISIS PENGARUH NILAI TUKAR, TINGKAT SUKU BUNGA, JUMLAH UANG BEREDAR DAN PERTUMBUHAN EKONOMI TERHADAP INDEKS HARGA SAHAM GABUNGAN DI BURSA EFEK INDONESIA PERIODE TAHUN 2004-2018. Sarjana thesis, Universitas Siliwangi.

GINANJAR, YUDI (2018) PERBANDINGAN MODEL PEMBELAJARAN GROUP INVESTIGATION DAN PROBLEM BASED LEARNING TERHADAP KEMAMPUAN BERFIKIR KREATIF SISWA (Studi Quasi Eksperimen pada Mata Pelajaran Ekonomi Bisnis Kelas X OTKP SMK Sukapura Kab. Tasikmalaya Tahun Pelajran 2018/2019) SKRIPSI Diajukan Untuk Memenuhi Salah Satu Syarat Dalam Memperoleh Gelar Sarjana Pendidikan. Sarjana thesis, Universitas Siliwangi.

GUMILAR, WANDA AGUNG (2022) ANALISIS FAKTOR- FAKTOR YANG MEMPENGARUHI PENERIMAAN INDUSTRI ALAS KAKI (Studi Kasus Industri Alas Kaki di Kecamatan Mangkubumi Kota Tasikmalaya ). Sarjana thesis, Universitas Siliwangi.

GUNAWAN, ARDI (2019) ANALISIS PENGENDALIAN PERSEDIAAN BARANG JADI DI PT. VICTORIA CARE INDONESIA. Sarjana thesis, Universitas Siliwangi.

GUNAWAN, RIDWAN (2022) PENGARUH FEE BASED INCOME DAN NON PERFORMING LOAN TERHADAP RETURN ON ASSETS (Kasus Pada PT. Bank Danamon Tbk.). Sarjana thesis, Universitas Siliwangi.

GUNAWAN, YUDI ARIYADI (2019) PENGARUH INOVASI PRODUK, CITRA MEREK, KUALITAS PRODUK TERHADAP LOYALITAS PELANGGAN (Penelitian di Sabilla Bordir Kawalu Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Gandi, Putri Diani (2020) PENGARUH MODAL DAN INOVASI PRODUK TERHADAP PENGEMBANGAN PRODUK OLAHAN MAKANAN DI UMK KEC. LEUWISARI KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Gunawan, Tia Lisiani Tri (2020) PROSEDUR PEMBAYARAN DANA PENSIUN SECARA TUNAI DAN TRANSFER PADA PT. TASPEN (PERSERO) KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Gunawan, Tia Lisiani Tri (2020) PROSEDUR PEMBAYARAN DANA PENSIUN SECARA TUNAI DAN TRANSFER PADA PT. TASPEN (PERSERO) KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Gusandi, Alvin (2019) ANALISIS STRATEGI PROMOSI DAN KUALITAS PRODUK DALAM MENGHADAPI PERSAINGAN BISNIS PADA TOKO MEBEL DASAR MILIK TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

H

HADI, GURUH AMIN (2022) ANALISIS FAKTOR–FAKTOR YANG MEMPENGARUHI PENDAPATAN PEDAGANG NASI GORENG DI KECAMATAN TAWANG KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

HADIPUTRI, NURFITRIYANI (2021) HEDONISME DALAM PERSPEKTIF TEORI DRAMATURGI ERVING GOFFMAN (Kualitatif Pada Mahasiswa Jurusan Pendidikan Ekonomi Angkatan 2016). Sarjana thesis, Universitas Siliwangi.

HAETI, SYARAH ALVIA (2019) PENGARUH JUMLAH INDUSTRI BESAR DAN SEDANG, PERTUMBUHAN EKONOMI, DAN UPAH MINIMUM TERHADAP PENYERAPAN TENAGA KERJA PERIODE 2003 s.d. 2017. Sarjana thesis, Universitas Siliwangi.

HAIRUNISA, MUTIA (2021) PENGARUH CASH RATIO ROE DAN CAR TERHADAP RETURN SAHAM PT BANK PANIN DUBAI SYARIAH TBK PERIODE 2017 – 2019. Sarjana thesis, Universitas Siliwangi.

HAKIM, SAEPUL (2021) PENGARUH EFIKASI DIRI DAN LINGKUNGAN KELUARGA TERHADAP HASIL BELAJAR MAHASISWA DALAM PEMBELAJARAN DARING PADA MASA PANDEMI COVID 19 (Survei Pada Mahasiswa Angkatan 2019 Fakultas Keguruan Dan Ilmu Pendidikan Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

HAMDANI, SANSAN FARDAN (2022) PENGARUH DANA ALOKASI UMUM, DANA ALOKASI KHUSUS DAN PENDAPATAN ASLI DAERAH TERHADAP KEMISKINAN DI KABUPATEN TASIKMALAYA TAHUN 2007-2020. Sarjana thesis, Universitas Siliwangi.

HAMDAYANI, AAM (2019) PENGARUH PEMBERIAN REWARD AND PUNISHMENT TERHADAP MOTIVASI SERTA IMPLIKASINYA TERHADAP PRESTASI BELAJAR MATA PELAJARAN EKONOMI KELAS XI MAN 2 TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

HAMIDAH NUR ROHMAH, HEMI (2019) PENGARUH LINGKUNGAN KELUARGA TERHADAP MINAT MELANJUTKAN PENDIDIKAN KE PERGURUAN TINGGI DI SMA NEGERI 10 TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

HANAFI, IMAM FAIZAL (2021) PENGARUH KUALITAS LAYANAN, PENANGANGAN KOMPLAIN, DAN CITRA PERUSAHAAN TERHADAP LOYALITAS NASABAH DI PT. BANK MUAMALAT INDONESIA CABANG TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

HANDAYANI SITANGGANG, DEVI (2019) ANALISIS INFLASI DI INDONESIA TAHUN 2008-2018. Sarjana thesis, Universitas Siliwangi.

HANIPAH, MILA (2021) PENGARUH E-SERVICE QUALITY TERHADAP KEPUASAN NASABAH PENGGUNA MOBILE BANKING PT. BNI SYARIAH KC TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

HAPSARI, DEVINA NIDAR (2020) ANALISIS SEKTOR EKONOMI UNGGULAN WILAYAH KOTA DI JAWA BARAT TAHUN 2014-2018. Sarjana thesis, Universitas Siliwangi.

HAQUE, MUHAMAD IRFAN IMANUL (2021) PENGARUH FRAMING DISCOUNT, TAGLINE GRATIS ONGKIR (ONGKOS KIRIM), REPUTASI MEREK DAN CITRA MEREK TERHADAP KEPUTUSAN PEMBELIAN (Studi pada Konsumen Fashion e-Commerce Shopee Indonesia). Pascasarjana thesis, Universitas Siliwangi.

HASANUDDIN, ALFI (2021) PENGARUH PENDIDIKAN KEWIRAUSAHAAN DAN LINGKUNGAN KELUARGA TERHADAP MINAT BERWIRAUSAHA MAHASISWA (Survey pada Mahasiswa Jurusan Pendidikan Ekonomi Fakultas Keguruan dan Ilmu Pendidikan Universitas Siliwangi Angkatan 2018 ). Sarjana thesis, Universitas Siliwangi.

HASANUDIN BUDIANA, DIAN (2019) PENGARUH PENGAWASAN INTERNAL, PERENCANAAN KEUANGAN DESA, KOMPETENSI APARATUR DESA, KOMITMEN ORGANISASI DAN PARTISIPASI ANGGARAN TERHADAP KINERJA KEUANGAN PEMERINTAH DESA DI KAB. TASIKMALAYA (Sensus pada 5 Kecamatan : Cisayong, Sukahening, Sukaratu, Rajapolah dan Jamanis). Pascasarjana thesis, UNIVERSITAS SILIWANGI.

HASTARINI, NURUL (2020) ANALISIS FAKTOR-FAKTOR PENENTU KEPUTUSAN PEMBELIAN FASHION SECARA ONLINE (Studi Kasus pada Mahasiswa Fakultas Ekonomi dan Bisnis Universitas Siliwangi ). Sarjana thesis, Universitas Siliwangi.

HEDISUKMAJI, HILMI (2022) PENGARUH TINGKAT PENGANGGURAN, TINGKAT KEMISKINAN DAN INDEKS PEMBANGUNAN MANUSIA TERHADAP PERTUMBUHAN EKONOMI DI PROVINSI JAWA BARAT PADA TAHUN 2009-2019. Sarjana thesis, Universitas Siliwangi.

HERAWATI, RIANA (2020) PENGARUH LITERASI KEUANGAN, KONTROL DIRI DAN GAYA HIDUP BERBELANJA TERHADAP PERILAKU KONSUMTIF (Survey Pada Pengusaha di Wilayah Tengah Kabupaten Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

HERDIANA, HERDIANA (2018) PENGARUH IMPLEMENTASI SISTEM MERIT TERHADAP KINERJA PEGAWAI NEGERI SIPIL (Penelitian pada Sekretariat Daerah Kota Tasikmalaya). Pascasarjana thesis, Universitas Siliwangi.

HERDIANTI, CINDY FAUZI (2022) PENGARUH HUMAN CAPITAL, SOCIAL CAPITAL DAN MOTIVASI TERHADAP KESIAPAN KERJA MAHASISWA S1 ANGKATAN 2017 UNIVERSITAS SILIWANGI. Sarjana thesis, Universitas Siliwangi.

HERLIYANI, LINA (2019) PENGARUH SUPERVISI AKADEMIK DAN MOTIVASI KERJA TERHADAP KINERJA GURU EKONOMI SMA/MA NEGERI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

HERYANTI, TANIA PUTRI (2021) PENGARUH PELATIHAN, KOMUNIKASI DAN DISIPLIN KERJA TERHADAP KINERJA KARYAWAN (Suatu Penelitian Terhadap Karyawan Non-Manager PT. Wahana Ottomitra Multiartha Tbk Cabang Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

HIDAYAT, ARIS FIRMAN (2021) ANALISIS IMPLEMENTASI SISTEM BAGI HASIL PADA TAMBAK UDANG VANAME DI CIKALONG TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

HIDAYAT, DICKY SUTRESNA (2021) PENGARUH PAJAK DAERAH, DANA ALOKASI UMUM, DANA ALOKASI KHUSUS DAN DANA BAGI HASIL TERHADAP BELANJA MODAL (Studi Kasus Pada 34 Provinsi di Indonesia Tahun 2008-2019). Sarjana thesis, Universitas Siliwangi.

HIDAYAT, ELSA AGUSTINA (2018) PENGARUH MINAT BELAJAR DAN KOMPETENSI PEDAGOGIK GURU TERHADAP PRESTASI BELAJAR SISWA PADA MATA PELAJARAN EKONOMI (Survei Pada Siswa Kelas XI di Madrasah Aliyah Negeri Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

HIDAYAT, LUTFI FAUZI (2019) PENGARUH MOTIVASI, BUDAYA ORGANISASI DAN ETOS KERJA TERHADAP KINERJA ANGGOTA DPRD (Sensus Pada DPRD Kabupaten Garut, Kabupaten dan Kota Tasikmalaya). Pascasarjana thesis, Universitas Siliwangi.

HIDAYAT, MUHAMMAD (2020) PROSEDUR PEMBERIAN KREDIT PENSIUN HYBRID PADA PT. BANK WOORI SAUDARA INDONESIA 1906, Tbk KANTOR CABANG PEMBANTU CIAMIS. Diploma thesis, Universitas Siliwangi.

HIDAYAT, RIKI (2019) PENGARUH PENGETAHUAN PERKOPERASIAN DAN KEMAMPUAN MANAJERIAL PENGURUS TERHADAP PARTISIPASI ANGGOTA KOPERASI SISWA (Survei Pada Koperasi Siswa MAN 1 Kabupaten Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

HILMI, ASEP IHSAN (2020) ANALISIS KOMPETENSI ACCOUNT OFFICER DAN MARKETING DI KSPPS TUNAS ARTHA MANDIRI SYARIAH CABANG SINGAPARNA. Sarjana thesis, Universitas Siliwangi.

HULUK, IQBAL AHSANUL (2021) PENGARUH PELATIHAN DAN DISIPLIN KERJA TERHADAP KINERJA KARYAWAN (Suatu Penelitian Pada PT. Cakra Putra Parahyangan Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

HUSAIN, INJA ALI (2019) ANALISIS STRATEGI PEMASARAN DALAM PERSAINGAN PASAR PADA DEPOT AIR MINUM AL-FATAH KARANGNUNGGAL. Sarjana thesis, Universitas Siliwangi.

Halisa, Nur (2022) PENGARUH ONLINE CUSTOMER REVIEW DAN SISTEM PEMBAYARAN CASH ON DELIVERY (COD) TERHADAP MINAT BELI KONSUMEN PADA APLIKASI LAZADA (Studi Pada Mahasiswa Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

Hardiati, Tri (2021) ANALISIS KEPUASAN NASABAH DENGAN PELAYANAN LANGSUNG DAN PELAYANAN DIGITAL DI BANK SYARIAH INDONESIA KCP CILACAP DIPONEGORO. Sarjana thesis, Universitas Siliwangi.

Hartiyanti, Yanti (2021) PENGARUH GAYA HIDUP, RELIGIOSITAS, LINGKUNGAN KELUARGA, DAN LINGKUNGAN TEMAN SEBAYA TERHADAP PERILAKU KONSUMTIF PADA PAKAIAN MUSLIMAH (Survei pada Mahasiswi Universitas Siliwangi Tasikmalaya Angkatan 2017-2020). Sarjana thesis, Universitas Siliwangi.

Hasanah, Uswatun (2019) PENGARUH LINGKUNGAN SEKOLAH DAN MOTIVASI BELAJAR TERHADAP HASIL BELAJAR SISWA (Survey Terhadap Siswa Peminatan IPS Pada Mata Pelajaran Ekonomi di SMA Muhammadiyah Kota Tasikmalaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

Hasnara, Gita (2019) PENGARUH LINGKUNGAN SEKOLAH DAN GAYA BELAJAR TERHADAP PRESTASI BELAJAR PESERTA DIDIK (Survei Pada Peserta Didik Kelas X dan XI di SMA Negeri 3 Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Hastulis Lestari Komarlina, Dwi and Wahyu, Budhi (2012) Analisis Potensi Kerajinan Industri Makanan Olahan di Kabupaten Tasikmalaya. JURNAL ILMU EKONOMI, 2 (1). pp. 288-310. ISSN 2301-8828

Hastuti Lestari Komarlina, Dwi Analisi Faktor-Faktor yang Mempengaruhi Inflasi di ndonesia Tahun 2000-2014. Jurnal Nasional.

Hastuti Lestari Komarlina, Dwi Analisi Pengaruh Variabel Moneter terhadap Harga Saham Properti Indonesia ( Manggunkan Uji Engle-Granger Error Correction Model. EG-ECM.0 (1). Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi Analisis Ekspor Teh di Indonesi Periode Tahun 1990-2008. Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi Analisis Ekspor Teh di Indonesi Periode Tahun 1990-2008. Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi Analisis Faktor Penentu Pertumbuhan Ekonomi dan Kebutuhan Investasi di Jawa Barat Tahun 2002-2011. Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi Analisis Potensi Kerajinan Industri Makanan Olahan di Kabupaten Tasikmalaya. Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi Analisisi Kinerja Keuangan dan Kesehatan Perusahaan Daerah Pasar Resik Kota Tasikmalaya. Hasil Reviewerl.

Hastuti Lestari Komarlina, Dwi Analytical Hierarchy Process (AHP). Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi (ITGbM) Pelatihan Pengolahan Makanan Berbahan Baku Lokal; Model Pemberdayaan Perempuan dalam Pengembagan Wisata Kuliner di Kawasan Wisata Jojongan Desa Kecam. Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi (ITGbM) Pengembangan Jaringan Pasar Produk Lebah Madu di Desa Cintaratu Kecamatan Paringi Kabupaten Pangandaran. Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi (IbID) Pelatihan Menghias Kue Tart dan Hantaran Seserahan; Model Pemberdayaan Permpuan dalam Penigkatan Kesejahteraan Keluarga di Desa Cintaratu dan Cintakarya Kecamatan Pariri Kabupaten Pangandaran. Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi MEASUREMENT OF TOURIST SATISFACTION BASED ON BEACH ATTRACTION PRODUCT ATTRIBUTES. Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi Market-Segmentation-Targeting-Strategy-And-Positioning-Strategy-Performance-Effects-To-The-Tourists-Satisfaction-research-In-Pangandaran-Beach-Pangandaran District). Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi Pengaruh Inflasi, Tenaga Kerja dan Kurs Terhadap Investasi di Provinsi Jawa Barat (1). Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi Pengaruh Inflasi, Tenaga Kerja dan Kurs Terhadap Investasi di Provinsi Jawa Barat (1). Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi Pengaruh Kualitas Pelayanan terhadap Kepuasan Pemakai Kios Pasar di UPTD Koperasi dan Pasar Guntur Ciawitali Kabupaten Garut (2). Jurnal Nasional.

Hastuti Lestari Komarlina, Dwi and Budi, Chandra (2011) Analisis Pengaruh Variabel Moneter terhadap Harga Saham Properti Indonesia (Menggunakan Uji Engel-Granger Error Correction Model . Eg-Ecm.). JURNAL ILMU EKONOMI, 1 (1). pp. 1-16. ISSN 2301-8828

Hastuti Lestari Komarlina, Dwi and Kadarisman, Encang and Abdul Rohman, Aab (2016) Pengaruh Pengeluaran Pemerintah dan PDRB terhadap PAD Provinsi Jawa Barat (1). JURNAL ILMU EKONOMI, 6 (2). ISSN 2301-8828

Herawati, Erma (2020) STRATEGI PENGEMBANGAN USAHA KERUPUK MIRASA CIAMIS. Sarjana thesis, Universitas Siliwangi.

Herawati, Keukeu (2022) PENGARUH HARGA, BRAND AWARENESS DAN RELIGIUSITAS TERHADAP KEPUTUSAN PEMBELIAN PRODUK KOSMETIK DAN PERSONAL CARE HALAL (Studi Kasus Pada Pengguna MarketPlace Shopee). Sarjana thesis, Universitas Siliwangi.

Herawati, Linda (2020) PENGARUH PEMBIAYAAN GADAI EMAS TERHADAP LABA BERSIH DI BANK BJB SYARIAH KCP SUMEDANG. Sarjana thesis, Universitas Siliwangi.

Herdiansyah, Deni (2020) ANALISIS STRATEGI PEMASARAN DALAM MENINGKATKAN VOLUME PENJUALAN PADA BASO KEMASAN MANG IPI DI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Hermansyah, Rizky Nugraha (2019) PENERAPAN MODEL PEMBELAJARAN DISCOVERY LEARNING DENGAN MENGGUNAKAN MEDIA KARTUN DALAM MENINGKATKAN KEMAMPUAN ANALISIS SISWA. Sarjana thesis, Universitas Siliwangi.

Hiaroh, Adella Nahriyatul (2022) PENGARUH FINANCING TO DEPOSIT RATIO (FDR) DAN BIAYA OPERASIONAL TERHADAP PENDAPATAN OPERASIONAL (BOPO) TERHADAP RETURN ON EQUITY (ROE) PADA PT. BANK BCA SYARIAH PERIODE 2011-2020. Sarjana thesis, Universitas Siliwangi.

Hidayat, Rizal Maulana (2021) MPLEMENTASI PRINSIP ETIKA BISNIS ISLAM DALAM KERJASAMA USAHA RENTAL MOBIL DI LAGANZA RENT CAR. Sarjana thesis, Universitas Siliwangi.

Hilalludin, Teja (2019) PENGARUH PERHATIAN ORANG TUA TERHADAP KEDISIPLINAN BELAJAR PESERTA DIDIK DAN DAMPAKNYA TERHADAP HASIL BELAJAR (Survey pada Peserta didik Kelas XI di SMA Negeri 1 Manonjaya). Sarjana thesis, Universitas Siliwangi.

Hoeriah, Rieda Siti (2021) PENGARUH KONDISI SOSIAL EKONOMI KELUARGA SERTA PEMBERIAN MOTIVASI OLEH GURU TERHADAP MINAT PESERTA DIDIK SMAN 4 TASIKMALAYA UNTUK MELANJUTKAN KULIAH (Penelitian kepada peserta didik kelas XII SMAN 4 Tasikmalaya tahun ajaran 2020/2021). Sarjana thesis, Universitas Siliwangi.

Hoerunisa, Lusi (2022) PROSEDUR PEMBUKAAN REKENING TABUNGAN SIMPEDES SECARA ONLINE MELALUI WEBSITE PADA PT. BANK RAKYAT INDONESIA (PERSERO) TBK UNIT CIKONENG CIAMIS. Sarjana thesis, Universitas Siliwangi.

Husni Mubarok, Roni (2019) ANALISIS PERANAN UPT PASAR DALAM PENGAWASAN PERDAGANGAN DI PASAR CIAWI KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

I

IBRAHIM, MAKHYAR (2021) PENGARUH LINGKUNGAN KERJA DAN KEPUASAN KERJA TERHADAP KINERJA KARYAWAN (Suatu Penelitian Pada Karyawan Non Manajer Di Toserba Yogya Banjar). Sarjana thesis, Universitas Siliwangi.

IHSAN, MUHAMMAD NURUL (2022) PENGARUH HARGA TIKET, KUALITAS PELAYANAN DAN FASILITAS TERHADAP KEPUTUSAN KONSUMEN DALAM MENGGUNAKAN JASA TRANSPORTASI PRIMAJASA DI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

IKHSAN, IQRA IKHWANUL (2020) ANALISIS KEPUASAN ANGGOTA KOPERASI 212 MART TASIKMALAYA DENGAN MENGGUNAKAN METODE IMPORTANCE PERFORMANCE ANALYSIS. Sarjana thesis, Universitas Siliwangi.

ILYAS, FRANSDITO ALI (2021) PENGARUH LEVERAGE DAN EFISIENSI OPERASI TERHADAP RETURN ON ASSETS (Studi Kasus Pada Bank Umum Konvensional Yang Tercatat Sebagai BUMN di Bursa Efek Indonesia Periode 2011-2020). Sarjana thesis, Universitas Siliwangi.

IMAN, RONA SAEFUL (2019) PENGARUH KUALITAS PRODUK DAN HARGA TERHADAP KEPUTUSAN PEMBELIAN PADA DISTRO LANGKY TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

IMAYANTI, IMAYANTI (2021) PENGARUH KUALITAS LAYANAN MOBILE BANKING TERHADAP KEPUASAN NASABAH BANK SYARIAH (Studi Kasus Mahasiswa Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

INDIRAGUSTIANI, SASKIA (2020) PENGARUH BIAYA PRODUKSI DAN BIAYA PROMOSI TERHADAP HARGA JUAL (Studi Kasus Pada PT. Herlina Putra Block Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

INSANI, BUANA NUR (2022) ANALISIS DETERMINAN KETIMPANGAN PEMBANGUNAN DI PULAU JAWA TAHUN 2015-2019. Sarjana thesis, Universitas Siliwangi.

INTAN FITRIYANI, DEDE (2018) PENERAPAN MODEL PEMBELAJARAN KOOPERATIF TIPE GROUP INVESTIGATION (GI) TERHADAP HASIL BELAJAR PESERTA DIDIK (Studi Quasi Eksperimen pada Mata Pelajaran Ekonomi Kelas X IPS SMA NEGERI 8 Tasikmalaya Tahun Ajaran 2017/2018). Sarjana thesis, Universitas Siliwangi.

INTAN PERTIWI, DEWI (2019) PENGARUH DESAIN BANGUNAN, TATA LETAK FASILITAS DAN LOKASI TERHADAP DAYA SAING OPERASI (Survei Pada Customer Tungku Caffe & Resto Banjar). Sarjana thesis, UNIVERSITAS SILIWANGI.

IRFIANI, ASTRI (2022) MEKANISME PENYALURAN KREDIT USAHA RAKYAT JENIS MODAL KERJA PADA PT BANK NEGARA INDONESIA (PERSERO) Tbk KANTOR CABANG PEMBANTU CIAMIS. Diploma thesis, Universitas Siliwangi.

IRIAWAN, RIZKY HUSNI (2020) ANALISIS PENGENDALIAN KUALITAS PRODUK DENGAN MENGGUNAKAN TEKNIK SHEWHART (Kasus Pada PD. Ramayana Tikar Mendong Manonjaya Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

IRSAL, IRSAL (2020) PENGARUH ISLAMIC BRANDING DAN PHYSICAL EVIDENCE TERHADAP MINAT BELI DI AL-MUSLIM MART KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

ISKANDAR, YASRIL NUR (2021) ANALISIS AKSESIBILITAS DAN AMENITAS DALAM PENGEMBANGAN PARIWISATA HALAL DI DESA NANGGEWER KECAMATAN PAGERAGEUNG KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

ISLAMI, YASISCA SHIDQIN NOOR RAHMAH (2022) PENGARUH NON PERFORMING FINANCING, RASIO EFISIENSI, FINANCING TO DEPOSIT RATIO TERHADAP PROFITABILITAS (Sensus Pada Bank Umum Syariah yang Terdaftar di Otoritas Jasa Keuangan). Sarjana thesis, Universitas Siliwangi.

ISLAMI (), YASISCA SHIDQIN NOOR RAHMAH (2022) PENGARUH NON PERFORMING FINANCING, RASIO EFISIENSI, FINANCING TO DEPOSIT RATIO TERHADAP PROFITABILITAS (Sensus Pada Bank Umum Syariah yang Terdaftar di Otoritas Jasa Keuangan). Sarjana thesis, Universitas Siliwangi.

ISMA, MUTIARA NURUL (2021) ANALISIS PENGARUH INFLASI, SUKU BUNGA DAN INFRASTRUKTUR EKONOMI TERHADAP PENANAMAN MODAL ASING DI INDONESIA TAHUN 2005-2019. Sarjana thesis, Universitas Siliwangi.

IZZAH, FATIMAH AQIDATUL (2020) PELAKSANAAN SERVICE EXCELLENT OLEH CUSTOMER SERVICE DALAM UPAYA MENINGKATKAN PELAYANAN TERHADAP NASABAH PADA PT. BANK NEGARA INDONESIA (Persero) Tbk. KANTOR CABANG PEMBANTU (KCP) CIKURUBUK KOTA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Ilham, Muhammad Satriana (2021) ANALISIS STRATEGI FUNDRAISING DALAM PEMBERDAYAAN EKONOMI UMAT BERBASIS KOMUNITAS LOKAL DI LEMBAGA AMIL ZAKAT INFAQ SHADAQAH NAHDLATUL ULAMA (LAZISNU) KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Ilham, Muhammad Satriana (2021) ANALISIS STRATEGI FUNDRAISING DALAM PEMBERDAYAAN EKONOMI UMAT BERBASIS KOMUNITAS LOKAL DI LEMBAGA AMIL ZAKAT INFAQ SHADAQAH NAHDLATUL ULAMA (LAZISNU) KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Ilham, Randhika Dwi (2020) PENGARUH KOMUNIKASI MEREK DALAM MEMBANGUN KEPERCAYAAN MEREK MELALUI SIKAP TERHADAP MEREK (Kasus pada pengguna android di Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Insyanul Taufik, Hilmi (2019) ANALISIS EFEKTIVITAS PROGRAM PENGEMBANGAN USAHA OLAHAN MAKANAN DAN MINUMAN DI MITRA USAHA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Irham Pradana, Muhamad (2020) PENGARUH KERAGAMAN PRODUK DAN PERSEPSI HARGA TERHADAP KEPUASAN KONSUMEN ( STUDI KASUS DI TOKO OLEH – OLEH PANGESTU CIREBON). Sarjana thesis, Universitas Siliwangi.

Islami, Bunga Surya (2022) ANALISIS PENANGANAN PERILAKU MORAL HAZARD DALAM PEMBIAYAAN MURABAHAH DI KSPPS BMT MIFTAHUSSALAM. Sarjana thesis, Universitas Siliwangi.

Ismail, Aghni (2020) PENGARUH INVESTASI SEKTOR INDUSTRI, PDRB SEKTOR INDUSTRI, IPM DAN INFLASI TERHADAP PENYERAPAN TENAGA KERJA SEKTOR INDUSTRI DI PROVINSI JAWA TIMUR TAHUN 2003-2018. Sarjana thesis, Universitas Siliwangi.

J

JANNAH, ULFA KHURFATUL (2020) ANALISIS FUNGSI PEMASARAN PRODUK FUNDING DALAM MENINGKATKAN USAHA KSPPS BMT WIRA MANDIRI TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

JAYANDIKA, TEGAR (2021) ANALISIS SEKTOR BASIS DAN NON-BASIS KABUPATEN CIAMIS PERIODE TAHUN 2010 – 2019. Sarjana thesis, Universitas Siliwangi.

JOHANIANDA, TRESHA (2020) ANALISIS PEMBIAYAAN BMT AL ISLAM PANUMBANGAN CIAMIS DALAM MENGANTISIPASI PEMBIAYAAN BERMASALAH. Sarjana thesis, Universitas Siliwangi.

JULFA, FIRA MARIA (2020) PENGARUH LINGKUNGAN KELUARGA DAN KEPRIBADIAN TERHADAP MOTIVASI SERTA IMPLIKASINYA TERHADAP MINAT MENJADI GURU EKONOMI (Survey Pada Mahasiswa Jurusan Pendidikan Ekonomi Angkatan 2016 dan 2017 Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

Jaelani, Herdi (2020) ANALISIS IMPLEMENTASI PENGENDALIAN MUTU (QUALITY CONTROL) DI PD. TAMANSARI CHICKEN PROCESSING KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Joni, Joni and Rafiqi, Yosep and Marlina, Lina (2016) Analisis Perilaku Konsumen Terhadap Keputusan Menjadi Nasabah Dalam Memilih Pembiayaan Murabahah di BMT al-Hidayah Kawalu Tasikmalaya. JURNAL EKONOMI SYARIAH, 1 (1). pp. 75-86. ISSN 2548-5032

K

KAMARA DARMAWAN, MOHAMMAD (2020) PENGARUH LIKUIDITAS, PERTUMBUHAN PERUSAHAAN DAN KEPEMILIKAN INSTITUSIONAL TERHADAP KEBIJAKAN DIVIDEN (Survei Pada Perusahaan Rokok yang Terdaftar di Bursa Efek Indonesia Periode 2004-2018). Sarjana thesis, Universitas Siliwangi.

KARTIKA, SINDI SUKMA (2022) IMPLEMENTASI SISTEM PEMBAYARAN CASHLESS MELALUI BNI MOBILE BANKING UNTUK MENINGKATKAN DIGITALISASI PRODUK DI PT BANK NEGARA INDONEISA (PERSERO) TBK KANTOR KAS KAWALI. Diploma thesis, Universitas Siliwangi.

KEMAL, HUSNI (2020) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI IMPOR BAWANG PUTIH INDONESIA DARI CHINA TAHUN 2002-2017. Sarjana thesis, Universitas Siliwangi.

KHAIRUNNISA, ADELA (2022) PENGARUH INFLASI, EXCHANGE RATE, SUKU BUNGA DAN LAJU PERTUMBUHAN EKONOMI TERHADAP EKSPOR DIBEBERAPA NEGARA ASIA (INDONESIA, JEPANG, CHINA) PERIODE 2003-2018. Sarjana thesis, Universitas Siliwangi.

KHANSA, LUQYANA (2020) PENGARUH ANGGARAN BERBASIS KINERJA DAN KINERJA PELAYANAN PUBLIK TERHADAP AKUNTABILITAS PUBLIK (Survey Pada Satuan Kerja Perangkat Daerah Dinas Kependudukan Dan Catatan Sipil Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

KHANUM, ZHULLAIKA (2020) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI IMPOR BERAS DI INDONESIA TAHUN 2000-2018. Sarjana thesis, Universitas Siliwangi.

KHIZBULLAH, KHIZBULLAH (2019) PENGARUH PRODUKSI, HARGA INTERNASIONAL, INFLASI DAN NILAI TUKAR TERHADAP NILAI EKSPOR KAKAO SERTA DAMPAKNYA TERHADAP VALUE ADDED SEKTOR PERKEBUNAN DI INDONESIA TAHUN 2002-2017. Sarjana thesis, Universitas Siliwangi.

KHOLQILLAH, FIKRI (2020) PROSEDUR PEMBERIAN KREDIT MODAL KERJA KONSTRUKSI PADA PT. BANK PEMBANGUNAN DAERAH JAWA BARAT DAN BANTEN, Tbk. KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

KHOMSYAH, ARIFAH NURSYABANI (2021) PENERAPAN MODEL PEMBELAJARAN DISCOVERY LEARNING DALAM MENINGKATKAN HASIL BELAJAR SISWA (Studi kuasi Eksperimen pada mata pelajaran ekonomi kelas XI IPS SMA Terpadu Riyadlul Ulum Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

KISWANTO, SINGGIH (2019) ANALISIS PENDAPATAN ASLI DAERAH SEKTOR PARIWISATA DI KABUPATEN PANGANDARAN. Sarjana thesis, Universitas Siliwangi.

KOESDINAR, FARIED (2019) PENGARUH CITRA TOKO DAN LOKASI TERHADAP KEPUTUSAN PEMBELIAN (Survey Pada Konsumen Toko Onderdil Laksana Motor Singaparna). Sarjana thesis, Universitas Siliwangi.

KOMALASARI, RETNO (2022) PENGARUH AGLOMERASI INDUSTRI, TINGKAT PARTISIPASI ANGKATAN KERJA, TINGKAT UPAH DAN INDEKS PEMBANGUNAN MANUSIA TERHADAP PERTUMBUHAN EKONOMI DI JAWA BARAT PERIODE 2005-2020. Sarjana thesis, Universitas Siliwangi.

KULSUM, ELSA SITI (2022) PERAN PEMBIAYAAN MURABAHAH DALAM MENGEMBANGKAN USAHA MIKRO KECIL MENENGAH (UMKM) ANGGOTA KSPPS BMT MIFTAHUSSALAM. Sarjana thesis, Universitas Siliwangi.

KURDIANSYAH, KURDIANSYAH (2021) PENGARUH PDB DAN KURS RUPIAH-USD TERHADAP INVESTASI PORTOFOLIO ASING DI INDONESIA. Sarjana thesis, Universitas Siliwangi.

KURNIA, LAWREND (2019) PENGARUH MODAL DAN TENAGA KERJA TERHADAP PRODUKSI BATIK DI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

KURNIA, NOER IMAN (2018) PENERAPAN MODEL PEMBELAJARAN KOOPERATIF TIPE KANCING GEMERINCING DALAM MENINGKATKAN HASIL BELAJAR SISWA (Studi Quasi Eksperimen Pada Siswa kelas X IPS di SMAN 2 Singaparna Kabupaten Tasikmalaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

KURNIANI, ALIN (2021) PENGARUH PENGETAHUAN PERKOPERASIAN DAN KREATIVITAS PENGURUS TERHADAP KOMITMEN ORGANISASI DAN IMPLIKASINYA TERHADAP PARTISIPASI ANGGOTA (Survey Pada Anggota Koperasi Mahasiswa Universitas Siliwangi Periode 2020). Sarjana thesis, Universitas Siliwangi.

KURNIAWAN, HADI (2019) PENGARUH EFIKASI DIRI DAN LOCUS OF CONTROL TERHADAP MINAT MENJADI GURU EKONOMI (Survey Pada Mahasiswa Jurusan Pendidikan Ekonomi angkatan2015/2016 Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

KURNIAWAN, PRATOMO GUSTI (2020) ANALISIS DETERMINAN EKSPOR NANAS INDONESIA PERIODE TAHUN 2001-2018. Sarjana thesis, Universitas Siliwangi.

Kamarullah, Yusrin (2019) PENGARUH MODAL KERJA DAN AKTIVA TETAP TERHADAP PROFITABILITAS (Survey pada Perusahaan Food and Beverage yang terdaftar di Bursa Efek Indonesia periode 2012 - 2017). Sarjana thesis, Universitas Siliwangi.

Kamelia, Kamelia (2020) PENGARUH DANA PIHAK KETIGA, RASIO KECUKUPAN MODAL DAN PEMBIAYAAN BERMASALAH TERHADAP PEMBIAYAAN YANG DISALURKAN DI BANK SYARIAH MANDIRI PERIODE 2008-2018. Sarjana thesis, Universitas Siliwangi.

Kania, Wulan (2020) ANALISIS PEMBIAYAAN MUDHARABAH DALAM PERMODALAN UMKM DI KSPPS BMT AL-HIDAYAH TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Karimah, Amaliya Dwi Rizky (2021) ANALISIS IFAS DAN EFAS PROMOSI PEMBUKAAN REKENING ONLINE PADA BANK SYARIAH INDONESIA KCP CILACAP DIPONEGORO. Sarjana thesis, Universitas Siliwangi.

Kartawan, Kartawan and Marlina, Lina and Susanto, Agus (2018) Manajemen Sumberdaya Insani. In: Manajemen Sumber Daya Insani. LPPM Universitas Siliwangi, Tasikmalaya. ISBN 978-979-17561-2-9

Kartika, Sita Rahma (2022) ANALISIS PENGARUH INVESTASI MODAL ASING, TENAGA KERJA DAN KEMISKINAN TERHADAP PERTUMBUHAN EKONOMI DI JAWA BARAT TAHUN 2005-2021. Sarjana thesis, Universitas Siliwangi.

Kartika, Sita Rahma (2022) ANALISIS PENGARUH INVESTASI MODAL ASING, TENAGA KERJA DAN KEMISKINAN TERHADAP PERTUMBUHAN EKONOMI DI JAWA BARAT TAHUN 2005-2021. Sarjana thesis, Universitas Siliwangi.

Khairunnisa, Alya (2021) ANALISIS MEKANISME AKAD RAHN, QARDH DAN IJARAH PADA PRODUK PEMBIAYAAN MITRA EMAS IB MASLAHAH (STUDI KASUS DI BJB SYARIAH KCP CIAMIS). Sarjana thesis, Universitas Siliwangi.

Khasanah, Neng Rina Nurul (2020) ANALISIS PENYERAPAN TENAGA KERJA PADA SEKTOR INDUSTRI PENGOLAHAN MAKANAN DI KABUPATEN CIAMIS TAHUN 2005-2019. Sarjana thesis, Universitas Siliwangi.

Khoerunnisa, Fitria (2021) ANALISIS PENANGANAN RESCHEDULING PEMBIAYAAN BERMASALAH DI KOPERASI SERBA USAHA BMT AMANAH KABUPATEN BREBES PADA MASA PANDEMI COVID-19. Sarjana thesis, Universitas Siliwangi.

Khofia, Nida (2020) ANALISIS DAMPAK PEMBERDAYAAN ZAKAT PRODUKTIF TERHADAP KESEJAHTERAAN MUSTHAIK MENGGUNAKAN MODEL CIBEST DI BAZNAS KOTA BANJAR. Sarjana thesis, Universitas Siliwangi.

Khoirunnisa, Fika (2019) PENERAPAN METODE PEMBELAJARANQUANTUM TEACHING DENGAN MENGGUNAKAN MIND MAPPINGDALAM MENINGKATKAN PEMAHAMAN KONSEP SISWA (Studi Kuasi Eksperimen Mata Pelajaran Ekonomi pada Kelas XI IPS Tahun Ajaran 2019/2020 SMA Muhammadiyah Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Kholifah, Dhea Nur (2021) FAKTOR-FAKTOR YANG MEMPENGARUHI ADOPSI E-COMMERCE DAN PENGARUHNYA TERHADAP KINERJA UKM (Survey pada UKM di Kecamatan Tawang Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Khotimah, Devi (2019) PENGARUH FAKTOR PSIKOLOGI DAN SOSIAL TERHADAP KEPUTUSAN MENJADI ANGGOTA DI KSPPS BMT AL-ITTIHAD TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Khoyrulli, Rizqi (2021) ANALISIS MANAJEMEN PENDAYAGUNAAN DANA ZIS DALAM MENINGKATKAN PENDAPATAN MUSTAHIK DI BAZNAS KOTA BANJAR. Sarjana thesis, Universitas Siliwangi.

Krismayani, Suci (2020) PENGARUH KUALITAS PRODUK TERHADAP KEUNGGULAN BERSAING PADA PRODUK MUKENA BORDIR DI SUKARAJA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Kurniasih, Euis (2018) Perbandingan Penerapan Model Discovery Learning dan Problem Based Learning Dalam Meningkatkan Kemampuan Berpikir Kritis Siswa (Studi Quasi Eksperimen Pada Mata Pelajaran IPS SMP Negeri 12 Tasikmalaya Tahun Pelajaran 92017/2018). Sarjana thesis, Universitas Siliwangi.

Kusmayadi, Dedi and Badruzaman, Jajang (2017) Efficiency and Profitability of Islamic Banks in Indonesia. Hasil Uji Kemiripan, 23 (9). pp. 1-6. ISSN 8807-881

Kusmayadi, Dedi and Firmansyah, Irman and Badruzaman, Jajang (2017) THE IMPACT OF MACROECONOMIC ON NONPERFORMING LOAN: COMPARISON STUDY AT CONVENTIONAL AND ISLAMIC BANKING. Hasil Reviewer, 11 (2). pp. 193-216. ISSN P-ISSN: 1979-0724 E-ISSN: 2502-3993

Kusmayadi, Dedi and Rudiana, Dedi and Badruzaman, Jajang (2015) GOOD CORPORATE GOVERNANCE. Hasil Reviewer. pp. 1-158. ISSN 978 602 71896 1 4

Kusmayadi, Dedi and Rudiana, Dedi and Badruzaman, Jajang (2015) PEMODELAN TATAKELOLA SEKOLAH YANG BAIK PSCA RINTISAN SEKOLAH BERTARAF INTERNASIONAL (RSBI) DI KOTA TASIKMALAYA. Hasil Reviewer Proceeding Nasional. pp. 1-22. ISSN 978-602-1004-12-8

L

LASMANA, TAUFIQ INDRA (2020) PENGARUH PROFITABILITAS, ARUS KAS OPERASI DAN LEVERAGE TERHADAP KEBIJAKAN DIVIDEN (Survei pada Perusahaan Retail yang Terdaftar di Bursa Efek Indonesia Periode 2014 – 2018). Sarjana thesis, Universitas Siliwangi.

LASMANA, TAUFIQ INDRA (2020) PENGARUH PROFITABILITAS, ARUS KAS OPERASI DAN LEVERAGE TERHADAP KEBIJAKAN DIVIDEN (Survei pada Perusahaan Retail yang Terdaftar di Bursa Efek Indonesia Periode 2014 – 2018). Sarjana thesis, Universitas Siliwangi.

LESMANA, FEBRI (2021) PENGARUH PENGALAMAN MEREK DAN KOMUNIKASI PEMASARAN TERINTEGRASI MELALUI NILAI HUBUNGAN EMOSIONAL TERHADAP MINAT PEMBELIAN ULANG (Kasus Pada Konsumen Sepatu Bata di Indonesia). Sarjana thesis, Universitas Siliwangi.

LESTARI, NADYA AYU (2021) PENGARUH DISIPLIN, KUALITAS KEHIDUPAN KERJA, DAN STRES TERHADAP KINERJA KARYAWAN (Sensus pada Penyuluh Pertanian Pegawai Negeri Sipil (PNS) di Dinas Pertanian, Pangan, dan Perikanan Kabupaten Tasikmalaya). Pascasarjana thesis, Universitas Siliwangi.

LIANI, ALIA DESRI (2022) PENGARUH INTEREST INCOME, EFISIENSI OPERASI, DAN RISIKO KREDIT TERHADAP RENTABILITAS (Survei pada Perbankan yang Terdaftar Di Bursa Efek Indonesia Periode 2015-2020). Sarjana thesis, Universitas Siliwangi.

LIESTIANI, RANI (2019) PENGARUH PRESTISE PROFESI GURU DAN DUKUNGAN ORANG TUA TERHADAP MINAT MENJADI GURU. Sarjana thesis, Universitas Siliwangi.

LISNAWATI, VENA YULI (2020) ANALISIS PERTUMBUHAN JUMLAH UNIT USAHA, TENAGA KERJA DAN NILAI INVESTASI TERHADAP NILAI PRODUKSI SEKTOR INDUSTRI DI JAWA TIMUR PERIODE 2003 – 2018. Sarjana thesis, Universitas Siliwangi.

LISTIANI, LELLY (2020) PENGARUH PINJAMAN LUAR NEGERI, PENANAMAN MODAL ASING DAN NILAI TUKAR TERHADAP PERTUMBUHAN EKONOMI INDONESIA TAHUN 2004-2018. Sarjana thesis, Universitas Siliwangi.

LUDIYANI, SILVIA (2019) MEKANISME TABUNGAN PERENCANAAN MASA DEPAN (TAPENAS) PADA PT. BANK NEGARA INDONESIA (PERSERO) TBK. KANTOR KAS SUTISNA SENJAYA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

LUTFIYANTI, NILA (2019) PENGARUH KOMPETENSI PEDAGOGIK GURU DAN DISIPLIN KERJA GURU TERHADAP MINAT BELAJAR SISWA (Penelitian Survey terhadap Siswa pada Mata Pelajaran Ekonomi Kelas XI IPS SMA/MA Se-Wilayah Kecamatan Singaparna Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

Laksono, Wahyu Agung (2021) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI TINGKAT KEMISKINAN DI KABUPATEN BOGOR TAHUN 2010-2020. Sarjana thesis, Universitas Siliwangi.

Latipah, Hani (2021) ANALISIS DETERMINASI KEMISKINAN KOTA TASIKMALAYA TAHUN 2006-2019. Sarjana thesis, Universitas Siliwangi.

Latuperissa, Marlince (2019) PENGARUH INTELEGENSI DAN BAKAT SISWA TERHADAP HASIL BELAJAR SISWA DI SMK NEGERI 1 KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Lavia, Hani (2019) ANALISIS IMPLEMENTASI KARAKTERISTIK SYARI’AH MARKETING PADA PEMASAR PT BANK BJB SYARI’AH KCP. CIKURUBUK TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Lesmana Sari, Elis (2019) PENERAPAN MODEL PEMBELAJARAN AUDITORY, INTELLECTUALLY, REPETITION (AIR) BERBANTUKAN MEDIA VIDEO TERHADAP PEMAHAMAN KONSEP PESERTA DIDIK PADA MATA PELAJARAN EKONOMI KELAS X IPS SMA NEGERI 1 JATIWARAS. Sarjana thesis, Universitas Siliwangi.

Lestari, Putri Dwi (2022) STRATEGI KOMUNIKASI PEMASARAN PADA PRODUK PINJAMAN DI PT BANK MANDIRI TASPEN KANTOR CABANG PEMBANTU CIAMIS. Diploma thesis, Universitas Siliwangi.

Lestari, Rosa Citra (2021) ANALISIS KOMUNIKASI BISNIS MELALUI MEDIA SOSIAL FADHILA AQIQAH DALAM MEMASARKAN PRODUK. Sarjana thesis, Universitas Siliwangi.

Loviana, Lena (2019) PENGARUH PEMBERIAN REWARD DAN PUNISHMENT TERHADAP SIKAP SOSIAL (Survey Pada Peserta DidikKelasXI SMA Negeri 3 Kota Tasikmalaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

M

MAHMUDA, FAHRUL AFIN (2020) PROSEDUR PEMBERIAN KREDIT MULTIGUNA MAPAN (KMGM) PADA PD.BPR ARTHA GALUNGGUNG KANTOR PUSAT KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

MARAYANI, SITI HANA (2021) PENGARUH CAPITAL ADEQUACY RATIO (CAR) DAN BEBAN OPERASIONAL PENDAPATAN OPERASIONAL(BOPO) TERHADAP RETURN ON ASSETS (ROA) PADA PT BANK MAYBANK INDONESIA TBK. Sarjana thesis, Universitas Siliwangi.

MARDALENA, SITI NURFITRI (2020) PENGARUH SARANA PRASARANA DAN MOTIVASI BELAJAR PESERTA DIDIK TERHADAP HASIL BELAJAR (Study Survey Pada Peserta Didik Kelas X dan XI MAN 3 Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

MARDHIANA, CANDRA (2019) PENGARUH INOVASI, DESAIN PRODUK DAN DESAIN PROSES TERHADAP KUALITAS PRODUK PADA PERUSAHAAN CV. KS TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

MARTYANINGSIH, DWI (2019) PENERAPAN MODEL PEMBELAJARAN PROBLEM BASED LEARNING BERBANTUKAN MEDIA VIDEO DALAM MENINGKATKAN KEMAMPUAN BERPIKIR KREATIF DAN BERPIKIR KRITIS SISWA. Sarjana thesis, Universitas Siliwangi.

MARYANA, ADITTYA (2020) PELAKSANAAN SERVICE EXCELLENT OLEH CUSTOMER SERVICE PADA PT. BANK TABUNGAN NEGARA (PERSERO), Tbk. KANTOR KAS PADAYUNGAN TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

MARYANA, NINDYA (2019) PENGARUH KUALITAS LAYANAN TOKO ONLINE DAN MOTIF PEMBELIAN TERHADAP KEPUTUSAN PEMBELIAN MAHASISWA JURUSAN PENDIDIKAN EKONOMI (Survei Pada Mahasiswa Universitas Siliwangi Jurusan Pendidikan Ekonomi Angkatan 2017/2018). Sarjana thesis, Universitas Siliwangi.

MARYANA, RINA (2021) PENGARUH JENIS KELAMIN, TEMPAT TINGGAL, POLA ASUH ORANG TUA DAN TEMAN SEBAYA TERHADAP LITERASI KEUANGAN MAHASISWA (Survey Pada Mahasiswa Jurusan Pendidikan Ekonomi FKIP Universitas Siliwangi Angkatan 2016-2019). Sarjana thesis, Universitas Siliwangi.

MARYANI, YUYUN (2021) ANALISIS CADANGAN DEVISA DI INDONESIA PERIODE 2000-2019. Sarjana thesis, Universitas Siliwangi.

MASRIAH, IMAS SITI (2020) PENGARUH WORKING CAPITAL TURNOVER (WCTO), DEBT TO EQUITY RATIO (DER), INVENTORY TURNOVER (ITO) TERHADAP NET PROFIT MARGIN (NPM) (Kasus Pada PT. Kalbe Farma Tbk. Periode 2005-2019). Sarjana thesis, Universitas Siliwangi.

MASRUROH, RENI (2020) PENGARUH NET EXPORT, FOREIGN DIRECT INVESTMENT DAN UTANG LUAR NEGERI PEMERINTAH TERHADAP CADANGAN DEVISA NEGARA INDONESIA TAHUN 2004-2018. Pascasarjana thesis, Universitas Siliwangi.

MAUDI, DEVI (2020) MEKANI SMELAYANANBTN PAYROLL DIPT.BANKTABUNGANNEGARA ( PERSERO) , Tbk.KANTORKASPADAYUNGANTASI KMALAYA. Diploma thesis, Universitas Siliwangi.

MAULADHANITA, DICKA MAUDY (2020) PENGARUH JUMLAH UANG BEREDAR, INFLASI DAN INVESTASI TERHADAP NILAI TUKAR RUPIAH DI INDONESIA. Sarjana thesis, Universitas Siliwangi.

MAULANA, NANAN (2021) PENGARUH EFIKASI DIRI DAN LINGKUNGAN KELUARGA TERHADAP MINAT BELAJAR DAN IMPLIKASINYA TERHADAP HASIL BELAJAR (Survey Pada Siswa Kelas XI IPS SMA Negeri Se-Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

MAULANA, RIAN BACHTIAR (2020) PENGARUH RETURN ON ASSETS (ROA), RETURN ON EQUITY (ROE), DAN NET INTEREST MARGIN (NIM) TERHADAP NILAI PERUSAHAAN (Survey Pada Perbankan Yang Terdaftar Di Bursa Efek Indonesia Tahun 2015-2019). Sarjana thesis, Universitas Siliwangi.

MAULANA, ROBY ANUGRAH (2020) PENGARUH PROMOSI TERHADAP CITRA PERUSAHAAN PADA ROKOK PT DJARUM SUPER (Survey pada Konsumen Rokok Djarum Super di Gunung Putri Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

MAULANA, YUDI (2020) STRATEGI PENYELESAIAN KREDIT BERMASALAH DI PD. BPR ARTHA GALUNGGUNG CABANG MANONJAYA. Diploma thesis, Universitas Siliwangi.

MAULIDA, MUSTIKA (2021) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI TEACHING EFFICACY CALON GURU (Survei Pada Mahasiswa Fakultas Keguruan dan Ilmu Pendidikan Angkatan 2016 Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

MAULIDA, RIZKIA MUTIARA (2020) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI KEUNTUNGAN HOME INDUSTRY KERAJINAN TIKAR MENDONG DI KECAMATAN PURBARATU KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

MAULIDIANI, SELI (2021) ANALISIS KEMAMPUAN EKONOMIS INDUSTRI KREATIF DI KOTA BANJAR (Studi Kasus Pada Industri Kerajinan Berbahan Dasar Bambu). Sarjana thesis, Universitas Siliwangi.

MAULIDINA, TYAS (2019) DETERMINAN EKSPOR TEH INDONESIA TAHUN 2002-2017. Sarjana thesis, Universitas Siliwangi.

MAYA, ROSMAYANTI (2020) PENGARUH FINANCIAL LEVERAGE, PROFITABILITAS, DAN KESEMPATAN INVESTASI TERHADAP DIVIDEND PAYOUT RATIO (Penelitian pada PT. Kimia Farma Tbk). Sarjana thesis, Universitas Siliwangi.

MA’RIF, ASEP SYAMSUL (2020) ANALISIS PARTISIPASI TENAGA KERJA WANITA DI SEKTOR INFORMAL DALAM MENDUKUNG PENDAPATAN KELUARGA (STUDI KASUS DI PASAR MANIS KABUPATEN CIAMIS). Sarjana thesis, Universitas Siliwangi.

MEGA MARSELINA, BELLA (2021) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI EKSPOR CPO (CRUDE PALM OIL) KE TIONGKOK SERTA PENGARUHNYA TERHADAP CADANGAN DEVISA (PERIODE TAHUN 2005-2019). Sarjana thesis, Universitas Siliwangi.

MEIDIANTI SUNARYA, TANTI (2019) PENERAPAN MODEL PEMBELAJARAN INKUIRI TERBIMBING UNTUK MENINGKATKAN PEMAHAMAN KONSEP SISWA PADA MATA PELAJARAN EKONOMI (Studi Kuasi Eksperimen terhadap Siswa Kelas X IPS SMA Negeri 8 Tasikmalaya Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

MEILANI AHSANA PRAIKA, AYU (2019) PENERAPAN MODEL PEMBELAJARAN DISCOVERY LEARNING DALAM MENINGKATKAN KEMAMPUAN BERPIKIR ANALITIS SISWA PADA MATA PELAJARAN EKONOMI (Studi Quasi Eksperimen Kelas XI IPS MAN Kota Banjar Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

MELANI, ALFITRI (2021) PENGARUH NET PROFIT MARGIN, DEBT TO EQUITY RATIO DAN KEBIJAKAN DIVIDEN TERHADAP NILAI PERUSAHAAN (Survei pada Perusahaan Manufaktur sub sektor Food and Beverage yang Terdaftar di Bursa Efek Indonesia Periode 2016-2020). Sarjana thesis, Universitas Siliwangi.

MELDIRA, DELA (2022) ANALISIS KEPUASAN PENGGUNA JASA LAYANAN DI KANTOR IMIGRASI KELAS II NON TPI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

MELIAWATI, IMAS (2021) PENGARUH INFLASI, JUMLAH UANG BEREDAR, TINGKAT SUKU BUNGA DAN DEFISIT ANGGARAN TERHADAP PERTUMBUHAN EKONOMI INDONESIA TAHUN 2000-2019. Sarjana thesis, Universitas Siliwangi.

MEYLANI MEGAWATI, RANNY (2019) PENERAPAN MODEL PROBLEM SOLVING BERBANTUKAN METODE DEBAT DALAM MENINGKATKAN KEMAMPUAN BERPIKIR KRITIS PADA SISWA SMA NEGERI 7 KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

MH, R. BILQIS FIRDAUS (2021) ANALISIS BESARAN PENENTU KEPUASAN KONSUMEN USAHA SEBLAK KATENZO DI JALAN SILIWANGI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

MIRANDANI, DEDE SELLY (2021) ANALISIS BEBERAPA FAKTOR YANG MEMPENGARUHI TINGKAT PENGANGGURAN TERBUKA DI PULAU JAWA TAHUN 2009-2019. Sarjana thesis, Universitas Siliwangi.

MIRANDANI, DEDE SELLY (2021) ANALISIS BEBERAPA FAKTOR YANG MEMPENGARUHI TINGKAT PENGANGGURAN TERBUKA DI PULAU JAWA TAHUN 2009-2019. Sarjana thesis, Universitas Siliwangi.

MONICA, AMELIA (2020) PENGARUH RETURN ON ASSET (ROA), DEBT TO EQUITY RATIO (DER) DAN EARNING PER SHARE (EPS) TERHADAP HARGA SAHAM PT.INDOFOOD CBP SUKSES MAKMUR TBK. Sarjana thesis, Universitas Siliwangi.

MONIKA, GITA PUTRI (2020) PENGARUH BRAND CORPORATION DAN KUALITAS PELAYANAN JASA TERHADAP PROSES KEPUTUSAN PEMBELIAN AIR BERSIH PDAM TIRTA SUKAPURA KABUPATEN TASIKMALAYA (Survei Pada Ibu-Ibu Rumah Tangga Pengguna PDAM Di Perumahan Cintaraja Permai Desa Cikunir Kecamatan Singaparna). Sarjana thesis, Universitas Siliwangi.

MUFROH, ULPA MIFTAHUL (2021) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI HARGA SAHAM PT GUDANG GARAM TBK PERIODE TAHUN 2009-2019. Sarjana thesis, Universitas Siliwangi.

MUHAMAD RIYADI, TAUFIK (2019) ANALISIS STRUKTUR EKONOMI KABUPATEN CIAMIS TAHUN 2013-2017. Sarjana thesis, Universitas Siliwangi.

MUHAMMAD, RIFKI (2019) ANALISIS PENGELOLAAN WAKAF DI YAYASAN PONDOK PESANTREN NURUL HIDAYAH PURBARATU TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

MUHAMMAD ABABIL, ILYAS (2021) PENGARUH TUNJANGAN, DISIPLIN KERJA DAN LINGKUNGAN KERJA TERHADAP SEMANGAT KERJA PEGAWAI (Suatu Penelitian Terhadap Pegawai Kantor Dinas Perhubungan Kabupaten Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

MUHAMMAD HAKIKI, IKBAL (2019) ANALISIS POLA KONSUMSI SEBELUM DAN SESUDAH MENJADI DRIVER GO-JEK (Survey di Kecamatan Tawang Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

MUHAMMAD WIJAKSONO, DHIMAS (2019) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI NILAI EKSPOR KAYU MANIS INDONESIA PERIODE 2000-2017. Sarjana thesis, Universitas Siliwangi.

MUHARAM, FAHMI (2019) PENGARUH PENDIDIKAN KEWIRAUSAHAAN DAN LINGKUNGAN KELUARGA TERHADAP SIKAP KEWIRAUSAHAAN SISWA KELAS XI SMK NEGERI 2 KOTA TASIKMALAYA (Survey pada Siswa Kelas XI SMK Negeri 2 Kota Tasikmalaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

MUHSIN, AMIN (2020) PENGARUH LAJU PERTUMBUHAN EKONOMI, JUMLAH PENDUDUK DAN INFLASI TERHADAP PENERIMAAN PAJAK DAERAH KOTA TASIKMALAYA PERIODE TAHUN 2006-2018. Sarjana thesis, Universitas Siliwangi.

MULDIANI, YENI (2022) PENERAPAN BAURAN PEMASARAN (MARKETING MIX) PADA KREDIT PENSIUN (KUPEN) DI PT BANK WOORI SAUDARA INDONESIA 1906, Tbk. KANTOR CABANG PEMBANTU MANONJAYA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

MULYA PRATAMA, RICKY (2019) PENGARUH PEMELIHARAAN PERALATAN BATIK DAN PENGENDALIAN KUALITAS TERHADAP KEUNGGULAN BERSAING (Penelitian Pada Galeri Batik Deden Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

MULYA PRATAMA, RICKY (2019) PENGARUH PEMELIHARAAN PERALATAN BATIK DAN PENGENDALIAN KUALITAS TERHADAP KEUNGGULAN BERSAING (Penelitian Pada Galeri Batik Deden Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

MULYANA, ANDI ABDILLAH (2020) ANALISIS KINERJA PEMERINTAH DALAM MENGATASI KEMISKINAN DI KOTA TASIKMALAYA PERIODE 2009-2019. Sarjana thesis, Universitas Siliwangi.

MULYANI, SRI (2020) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI PENDAPATAN PEDAGANG DAGING AYAM DI PASAR SINGAPARNA KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

MULYANI, SRI (2020) PENGARUH E-COMMERCE TERHADAP PERTUMBUHAN SEKTOR PERDAGANGAN DI INDONESIA PERIODE 2009-2018. Sarjana thesis, Universitas Siliwangi.

MULYANINGSIH, SEVTY (2019) PENGARUH CARA BELAJAR DAN IKLIM SEKOLAH TERHADAP MOTIVASI BELAJAR SISWA (Survei pada Siswa SMA Muhammadiyah Kota Tasikmalaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

MUSTARI, ARIE WAHYU (2020) ANALISIS FAKTOR YANG MEMPENGARUHI VOLUME EKSPOR KARET ALAM INDONESIA KE AMERIKA SERIKAT PERIODE TAHUN 1990 – 2018. Sarjana thesis, Universitas Siliwangi.

MUSTIKA, AI (2020) PROSEDUR PEMBUKAAN REKENING TABUNGAN iB HIJRAH DENGAN AKAD WADI’AH YAD DHAMANAH PADA BANK MUAMALAT INDONESIA (BMI) KCP SINGAPARNA. Diploma thesis, Universitas Siliwangi.

MUTIARA, INDRI DWI (2020) ANALISIS MANAJEMEN RISIKO PRODUK PEMBIAYAAN GADAI EMAS SYARIAH DI BANK BJB SYARIAH KCP SUMEDANG. Sarjana thesis, Universitas Siliwangi.

MUTOHAROH, SITI ZAMILAH (2020) PENGGUNAAN FASILITAS E-BANKING PADA PT. BANK BRI SYARIAH KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

MU’MIN, ABDUL (2020) PENGARUH INVESTASI ASING LANGSUNG, EKSPOR DAN INDEKS PERSEPSI KORUPSI TERHADAP PERTUMBUHAN EKONOMI DI NEGARA ASEAN. Sarjana thesis, Universitas Siliwangi.

Maliha, Hasna and Marlina, Lina (2019) Mengapa Bank Syariah Relatif Lebih Tahan Krisis? Aplikasi Logistic Regression untuk Sistem Deteksi Dini Krisis Finansial di Indonesia. JURNAL EKONOMI SYARIAH, 1 (1). pp. 34-55. ISSN 2548-5032

Malikul Mulki, Riki (2019) ANALISIS EFISIENSI FAKTOR PRODUKSI PADA USAHA TANI KENTANG DI KELOMPOK TANI RAKSAWANA AGRO CIKANDANG GARUT. Sarjana thesis, Universitas Siliwangi.

Mardiani, Yesi (2020) PENGARUH HARGA DAN KUALITAS PELAYANAN TERHADAP KEPUTUSAN PEMBELIAN ANGGOTA KOPERASI MAHASISWA UNIVERSITAS SILIWANGI. Sarjana thesis, Universitas Siliwangi.

Mariah, Siti (2019) PENERAPAN MEDIA PEMBELAJARAN BERBASIS MACROMEDIA FLASH BERBENTUK ANIMASI UNTUK MENINGKATKAN HASIL BELAJAR PESERTA DIDIK PADA MATA PELAJARAN EKONOMI DI MAN 1 KOTA TASIKMALAYA (Studi Quasi Eksperimen pada Mata Pelajaran Ekonomi Kelas X IPS MAN 1 Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Marlina, Lina (2015) Faktor-Faktor yang Mempengaruhi Keputusan Menjadi Nasabah Bank Syariah. Jurnal Magister Manajemen Pascasarjana Unsll, 1 (1). pp. 32-45. ISSN 2085-7055

Marlina, Lina (2019) The Influence of Economic Growth, Job Opportunity and People Prosperity on Islamic Banking Growth in Six Provinces in Java Island. INTERNATIONAL JOURNAL OF NUSANTARA ISLAM, 7 (2). pp. 190-202. ISSN 2252-5904

Marlina, Lina TWENTY YEARS OF ISL Y YEARS OF ISLAMIC BANKING IN INDONESI AMIC BANKING IN INDONESIA A BIBLIOSHINY APPLICATION. Hasil Reviewer.

Marlina, Lina and Iskandar, Jajang (2019) Pengaruh Bagi Hasil dan Pendapatan Perkapita terhadap Peningkatan Dana Pihak Ketiga. JURNAL EKONOMI SYARIAH, 4 (1). pp. 1-17. ISSN 2548-5032

Marlina, Lina and Rusydiana, Aam Slamet and Otoillah, Muhammad Anton (2018) Malmquist Index To Measure the Efficiency and Productivity of Indonesia Islamic Banks. 2nd ICIFEB 2018 International Conference on Islamic Finance Economics and Business UIN Syarif Hidayatullah Jakarta.

Marlina, Lina and Sudana, Sudana (2020) Does The Population Number, The Economic Growth, and The Inflation Influence The Growth of Islamic Bank in Indonesia? Journal of Islamic Monetary Economics and Finance, 7 (5). pp. 723-729. ISSN 2394-5125

Marlina, Lina and Zahra Nasution, Fatimah (2016) Faktor-Faktor yang Mempengaruhi Keputusan Mahasiswa Memilih Program Studi Ekonomi Syariah Pada Fakultas Agama Islam Universitas Siliwangi. JURNAL EKONOMI SYARIAH, 1 (1). pp. 60-74. ISSN 2548-5032

Marlina, Lina and Zulfikar Rahmat, Biki (2018) Peran Lembaga Keuangan Syariah dalam Mengimplemen-tasikan Keuangan Inklusif bagi Pelaku UMKM Tasikmalaya. JURNAL ECODEMICA, 1 (2). pp. 125-135. ISSN 2355-0295

Marselina, Marselina (2020) ANALISIS EFEKTIVITAS PENJUALAN PRODUK UMKM MAKANAN OLAHAN BINAAN INOPAK INSTITUTE MELALUI PASAR MODERN DI TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Maryam, Siti (2020) ANALISIS PROGRAM KEWIRAUSAHAAN DALAM MENINGKATKAN WIRAUSAHA MAHASISWA DI UNIVERSITAS SILIWANGI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Maryanti, Anisa (2022) ANALISIS PENANGANAN RISIKO PEMBIAYAAN MURABAHAH PADA LEMBAGA KEUANGAN MIKRO SYARIAH DALAM MASA PANDEMI COVID-19 (Studi Kasus di BMT Al-Hidayah Kawalu Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Marzani, Yaumi Rachmadina (2021) ANALISIS KESEHATAN KOPERASI SIMPAN PINJAM PEMBIAYAAN SYARIAH SURYA UTAMA NUSANTARA PADA MASA PANDEMI COVID-19 TAHUN 2020. Sarjana thesis, Universitas Siliwangi.

Masitoh, Imas (2020) PENGARUH INOVASI PRODUK DAN HARGA JUAL TERHADAP MINAT BELI DI PERUSAHAAN KELOM GEULIS KARIMA KEY TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Masitoh, Imas (2020) PENGARUH INOVASI PRODUK DAN HARGA JUAL TERHADAP MINAT BELI DI PERUSAHAAN KELOM GEULIS KARIMA KEY TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Maulana, Azis (2019) ANALISIS KEPUTUSAN PEMBELIAN BERDASARKAN LABELISASI HALAL DI DEPOT JAMU HERBAL CIAWI TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Maulana, Fajar Syaban (2020) PENGARUH GAYA KEPEMIMPINAN DAN DISIPLIN KERJA TERHADAP KINERJA KARYAWAN KOPERASI SIMPAN PINJAM PEMBIAYAAN SYARIAH TUNAS ARTHA MANDIRI CABANG SINGAPARNA. Sarjana thesis, Universitas Siliwangi.

Maulana, Muhammad Zidan (2020) ANALISIS DAMPAK PERUBAHAN MEREK PADA PRODUK AIR MINUM DALAM KEMASAN DI PT NATA BERSAUDARA SEJAHTERA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Maulana, Reza (2020) PENGARUH HARGA DAN KUALITAS PELAYANAN TERHADAP KEPUTUSAN PEMBELIAN ULANG LAYANAN JASA TRANSPORTASI ONLINE (Studi Kasus Pengguna Grab di Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Maulida, Nur Afifah (2022) STRATEGI PENCEGAHAN PENCUCIAN UANG MELAUI KNOW YOUR CUSTOMER PRINCIPLES PADA PT BANK TABUNGAN NEGARA (PERSERO) Tbk KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Maya Mutiara, Radela (2018) PENERAPAN MODEL PEMBELAJARAN INKUIRI DALAM MENINGKATKAN KEMAMPUAN BERPIKIR KRITIS (Studi Quasi Eksperimen pada kelas XI IPS SMA Negeri 6 Tasikmalaya ). Sarjana thesis, Universitas Siliwangi.

Meiluwati, Andini (2020) PENGARUH DANA PIHAK KETIGA, PEMBIAYAAN BAGI HASIL DAN CAPITAL ADEQUACY RATIO TERHADAP RETURN ON ASSET PADA BANK MUAMALAT INDONESIA PERIODE 2008-2018. Sarjana thesis, Universitas Siliwangi.

Meiluwati, Andini (2020) PENGARUH DANA PIHAK KETIGA, PEMBIAYAAN BAGI HASIL DAN CAPITAL ADEQUACY RATIO TERHADAP RETURN ON ASSET PADA BANK MUAMALAT INDONESIA PERIODE 2008-2018. Sarjana thesis, Universitas Siliwangi.

Meliani, Wini (2021) ANALISIS KINERJA BAZNAS KOTA TASIKMALAYA DENGAN PENDEKATAN DIMENSI MAKRO BERDASARKAN INDEKS ZAKAT NASIONAL (IZN). Sarjana thesis, Universitas Siliwangi.

Milu, Tri Cahyani (2019) ANALISIS FAKTOR-FAKTOR INTERNAL DALAM PENGEMBANGAN USAHA BUBUR AYAM KALEKTORAN H. ZENAL KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Mochamad Thopik, Rizky (2018) ANALISIS IMPLEMENTASI AGUNAN PADA AKAD MUDHARABAH DAN MURABAHAH DI BMT AL-HIDAYAH KAWALU TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Muhamad, Mulyana (2020) ANALISIS KESEHATAN KOPERASI SIMPAN PINJAM SIMPENAN PAMEUNGKEUT BANDA (KSP SPB) TASIKMALAYA TAHUN 2017-2019. Diploma thesis, Universitas Siliwangi.

Muhamad Nur, Parid (2020) MEKANISME KLIRING DI PT. BANK NEGARA INDONESIA (PERSERO) Tbk. KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Muhammad, Yusuf Ali (2019) ANALISIS KEPUTUSAN MANAJER DALAM PERENCANAAN DAN PENGAWASAN DI JAPRI CORP TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Muhammad Lathif, Rizqi (2021) ANALISIS PENDAPATAN DAN R/C-RATIO PADA USAHA TELUR AYAM LOKAL DAN TELUR AYAM DARI JAWA TENGAH (Studi kasus pada pedagang Telur Ayam Lokal dan Telur Ayam dari Jawa Tengah di Pasar Cikurubuk Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Mulyadi, Sandi (2019) ANALISIS IMPLEMENTASI FUNGSI PENGORGANISASIAN DALAM PENGELOLAAN SUMBER DAYA INSANI DI KSPPS MITRA INSAN MANDIRI. Sarjana thesis, Universitas Siliwangi.

Mulyana, Deden ANALYSIS OF SHARES AND LIQUIDITY EFFECT SHARE PRICE ON THE COMPANY THAT IS ON THE STOCK EXCHANGE INDEX IN INDONESIA LQ45. Hasil Reviewer.

Mulyana, Deden Building Costumer Trust Through Experience On Healthcare Industry.

Mulyana, Deden Building the Brandldentiy thrugh Brand Differentiation Based Valueof Culture and Locally-global Product Principles(Case on the CityArt). Hasil Uji Kemiripan.

Mulyana, Deden Mellenial Urban Generations. Does Become 'A Current Generation' Shift Their Attention To Financial Literacy. Hasil Uji Kemiripan.

Mulyana, Deden Pengaruh Servicescape dan Citra Merek Terhadap Keputusan Pembelian (Studi pada Klinik Bersalin 'Bunga Mawarni' Kota Banjar). Hasil Reviewer.

Mulyana, Deden THE ROLE OF VALUE CO-CREATION BASED ON ENGAGEMENT TO DEVELOP BRAND ADVANTAGE. Hasil Reviewer.

Mulyana, Deden and Hastuti Lestari Komarlina, Dwi and Rustandi, Iyus (2013) Pengaruh Kualitas Pelayanan terhadap Kepuasan Pemakai Kios Pasar di UPTD Koperasi dan Pasar Guntur Ciawitali Kabupaten Garut. JURNAL ILMU EKONOMI. ISSN 2301-8828

Mulyana, Deden and Nurichani, Nila (2018) Factors Influencing Capital Expenditure. The 1st Inter-University Forum for Strengthening Academic Competency. pp. 35-43. ISSN 978-623-7111-21-4

Mulyana, Deden and Rudiana, Dedi and Rahmat Taufiq, Adhitya (2019) The Role Value Cocreation Based on Engagement to Develope Brand Advantage. Polish Journal of Management Studies, 20 (1). pp. 305-317. ISSN 2081-7452

Muslimah, Rifaatul (2021) ANALISIS PROGRAM PENDAMPINGAN WIRAUSAHA DALAM PEMBERDAYAAN MUSTAHIK PADA LEMBAGA AMIL ZAKAT NASIONAL INISIATIF ZAKAT INDONESIA KANTOR PUSAT JAKARTA. Sarjana thesis, Universitas Siliwangi.

Mutiara Sukma, Wulan (2020) PERAN TEKNOLOGI INFORMASI DAN KUALITAS LAYANAN DALAM MEMBERI KEPUASAN KEPADA NASABAH BANK BJB SYARIAH KCP GARUT. Sarjana thesis, Universitas Siliwangi.

N

NABABAN, RESTUADI (2020) ANALISIS SEKTOR UNGGULAN PROVINSI SUMATERA UTARA TAHUN 2010-2018. Sarjana thesis, Universitas Siliwangi.

NABIILAH, RACHEL (2021) PENGARUH PERSEPSI PESERTA DIDIK TENTANG METODE MENGAJAR GURU DAN CARA BELAJAR TERHADAP KESIAPAN BELAJAR DAN IMPLIKASINYA TERHADAP HASIL BELAJAR (Survey Pada Peserta Didik Kelas X dan XI IPS Mata Pelajaran Ekonomi SMA Negeri 8 Tasikmalaya Tahun Ajaran 2019/2020). Sarjana thesis, Universitas Siliwangi.

NABILA APRILIANI, NINDI (2019) PENGARUH KONDISI PESERTA DIDIK DAN SARANA PRASARANA BELAJAR DI SEKOLAH TERHADAP PRESTASI BELAJAR PADA MATA PELAJARAN EKONOMI (Survei Pada Peserta Didik Kelas X IPS SMA Islam Cipasung Kabupaten Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

NADYA, ASTRY (2019) PENGARUH PENGEMBANGAN PRODUK DAN PEMELIHARAAN MESIN TERHADAP KUALITAS PRODUK (Survey pada Perusahaan Pesack Clothes Tasikmalaya). Sarjana thesis, UNIVERSITAS SILIWANGI.

NASUTION, YULIA PUSPITA ANGGRAINI (2020) PENGARUH HARGA, PROMOSI PENJUALAN DAN KEPUASAN KONSUMEN TERHADAP PERILAKU PERALIHAN MEREK (BRAND SWITCHING BEHAVIOR) PRODUK KOSMETIK (Studi Kasus pada Marketplace Shopee). Sarjana thesis, Universitas Siliwangi.

NATSIR, MUHAMMAD IKRAM (2019) PENGARUH JUMLAH OBJEK DAYA TARIK WISATA, JUMLAH KUNJUNGAN WISATAWAN DAN INVESTASI SEKTOR PARIWISATA TERHADAP PENDAPATAN ASLI DAERAH SEKTOR PARIWISATA KABUPATEN KUNINGAN TAHUN 2009-2018. Sarjana thesis, Universitas Siliwangi.

NAZIHA, RYNA HADYA (2020) ANALISIS KUALITAS PELAYANAN SISTEM KLIRING PADA BANK MUAMALAT INDONESIA CABANG TASIKMALAYA DAN PENGARUHNYA TERHADAP LOYALITAS NASABAH. Sarjana thesis, Universitas Siliwangi.

NINGRUM, NESYA DESMAYATI (2020) PENGARUH MARKET CAPITALIZATION DAN TRADING VOLUME ACTIVITY TERHADAP RETURN SAHAM PADA PT. UNILEVER INDONESIA, TBK. Sarjana thesis, Universitas Siliwangi.

NINGSIH, DESI YULIA (2022) PROSEDUR PEMBERIAN KREDIT MIKRO UTAMA PERDAGANGAN PADA PT. BANK PEMBANGUNAN DAERAH JAWA BARAT DAN BANTEN Tbk. KANTOR CABANG PEMBANTU MANONJAYA. Sarjana thesis, Universitas Siliwangi.

NINGSIH, JULIANTI (2020) ANALISIS PERTUMBUHAN PENDAPATAN ASLI DAERAH SEKTOR PARIWISATA DI DAERAH WISATA UNGGULAN DI JAWA BARAT TAHUN 2014-2018. Sarjana thesis, Universitas Siliwangi.

NIRMALA, FANISA (2021) ANALISIS FAKTOR-FAKTOR MAKRO EKONOMI YANG MEMPENGARUHI FOREIGN DIRECT INVESTMENT DI INDONESIA TAHUN 2005-2019. Sarjana thesis, Universitas Siliwangi.

NIRMAYANI, . (2019) PENERAPAN MODEL PEMBELAJARAN INKUIRI TERBIMBING DALAM MENINGKATKAN KEMAMPUAN BERPIKIR KREATIF SISWA PADA MATA PELAJARAN EKONOMI (Studi Quasi Eksperimen pada Kelas XI IPS SMAN 1 Jatiwaras Kabupaten Tasikmalaya Tahun Pelajaran 2019/2020). Sarjana thesis, Universitas Siliwangi.

NISA, MUFLIHATUN (2020) PENGARUH PEMBIAYAAN BA’I BITHAMAN AJIL (BBA) KENDARAAN BERMOTOR TERHADAP PENINGKATAN PENDAPATAN BMT AL ISTIQOMAH CIAMIS PERIODE 2017-2019. Sarjana thesis, Universitas Siliwangi.

NISSA, FINA KHOIRUN (2020) ANALISIS SALURAN DISTRIBUSI DALAM MENINGKATKAN VOLUME PENJUALAN DI IMACELL CIAWI TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

NITASARI, FITRIA (2020) FAKTOR-FAKTOR YANG MEMPENGARUHI POLA PENGELUARAN MAHASISWA FAKULTAS EKONOMI UNIVERSITAS SILIWANGI. Sarjana thesis, Universitas Siliwangi.

NOEGRAHA, YANUAR YOAN PENGARUH KEPEMIMPINAN, IKLIM ORGANISASI DAN LINGKUNGAN KERJA TERHADAP KEPUASAN KERJA (Survei pada Pegawai Dinas di Lingkungan Pemerintah Kota Tasikmalaya). Sarjana thesis, UNSPECIFIED.

NOORISWARA, RIFA (2020) PENGARUH DESAIN PRODUK DAN PENGENDALIAN KUALITAS TERHADAP KUALITAS PRODUK PERUSAHAAN DAIWANI BORDIR. Sarjana thesis, Universitas Siliwangi.

NOVIA ADAWIAH, EUIS (2020) PENGARUH EARNING PER SHARE DAN DEBT TO EQUITY RATIO TERHADAP RETURN SAHAM DENGAN KEBIJAKAN DIVIDEN SEBAGAI INTERVENING (studi kasus pada PT. Unilever Indonesia, Tbk). Sarjana thesis, Universitas Siliwangi.

NUGRAHA, DIAN SEPTIAN (2021) DETERMINAN PENGELUARAN KONSUMSI PRODUK SKINCARE PADA PLATFORM MARKETPLACE (Studi Kasus pada Mahasiswa Fakultas Ekonomi Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

NUGRAHA, PANJI (2021) PENGARUH TOTAL QUALITY MANAGEMENT (TQM), PENERAPAN TEKNOLOGI E-BISNIS, DAN INTEGRASI RANTAI PASOKAN TERHADAP KINERJA OPERASI (Suryvey Pada Tiga UKM Busana Muslim di Wilayah Kecamatan Tawang Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

NUGRAHA, RAHMAN (2019) PENGARUH PENERAPAN MODEL PEMBELAJARAN PROBLEM BASED LEARNING (PBL) TERHADAP KEMAMPUAN BERPIKIR ANALITIS (Studi kuasi eksperimen peserta didik Kelas XI MIA MAN 3 Tasikmalaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

NUGRAHA, RIZKI (2020) UPAYA MEMBANGUN KEPERCAYAAN MELALUI KOMUNIKASI PEMASARAN (Survey Pada Konsumen Sepatu Ventella Bandung). Sarjana thesis, Universitas Siliwangi.

NUGRAINI, KANIA (2019) ANALISIS PENGARUH TENAGA KERJA, NILAI EKSPOR DAN JUMLAH PERUSAHAAN TERHADAP PRODUK DOMESTIK BRUTO (PDB) SUBSEKTOR INDUSTRI KREATIF DI INDONESIA TAHUN 2011-2016. Sarjana thesis, Universitas Siliwangi.

NUR FAUZIAH, ANITA (2017) PENGARUH DESAIN DAN KUALITAS PRODUK TERHADAP DAYA SAING (Studi Kasus Pada Konsumen Perusahaan Batik Deden Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

NUR RAMDHANI SUPRIADI, HADI (2019) PENGARUH MODAL TETAP, TENAGA KERJA DAN BAHAN BAKU TERHADAP HASIL PRODUKSI (Studi Kasus pada Industri Tikar Mendong di Kecamatan Purbaratu Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

NURAENI, RISMA (2021) PENGARUH KUALITAS PELAYANAN TERHADAP TINGKAT KEPUASAN KONSUMEN (NASABAH) BANK PERKREDITAN RAKYAT ARTHAGUNA MANDIRI DI KABUPATEN TASIKMALAYA (Penelitian Survey pada Nasabah PT. BPR Arthaguna Mandiri Singaparna Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

NURAENI, SRI (2020) PENGARUH LAJU PERTUMBUHAN EKONOMI, BI RATE, INFLASI, NILAI TUKAR, DAN PENANAMAN MODAL ASING TERHADAP INDEKS HARGA SAHAM GABUNGAN DI BEI TAHUN 2000 - 2018. Sarjana thesis, Universitas Siliwangi.

NURAINI, NURAINI (2020) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI KURS RUPIAH PERIODE 2004-2018. Sarjana thesis, Universitas Siliwangi.

NURALAMSYAH, FIKRI (2020) PENGARUH UMKM, TINGKAT UPAH, DAN MODAL TERHADAP TINGKAT PENGANGGURAN DI INDONESIA TAHUN 2005-2017. Sarjana thesis, Universitas Siliwangi.

NURAZIZAH, ADE TRI (2022) PENGARUH SALES GROWTH, PLOWBACK RATIO, RETURN ON ASSETS (ROA), DAN RETURN ON EQUITY (ROE) TERHADAP PERTUMBUHAN MODAL SENDIRI (Survei pada Perusahaan Perdagangan Eceran yang Terdaftar di Bursa Efek Indonesia Tahun 2015-2019). Sarjana thesis, Universitas Siliwangi.

NURDIANA, AGIN SEPTIAN FAJAR (2020) PENGARUH KECUKUPAN MODAL DAN KUALITAS AKTIVA PRODUKTIF TERHADAP RENTABILITAS (Studi Kasus Pada Emiten Perbankan di BEI). Sarjana thesis, Universitas Siliwangi.

NURDIANI, SRI KARTINI (2020) PENGARUH SISTEM PENILAIAN PRESTASI KERJA DAN PERSYARATAN JABATAN TERHADAP KINERJA PEGAWAI (Suatu Penelitian Pada Pegawai Non Manajer di PDAM Tirta Sukapura Kabupaten Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

NURDIN, SUGIH FATHWA (2018) PROSEDUR TRANSAKSI SIMPANAN GALUNGGUNG PRIMA MAPAN PADA PD.BPR ARTHA GALUNGGUNG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

NURHAFSAH, HUSNUL (2021) PENGARUH PENDIDIKAN KEUANGAN DI KELUARGA, PENDAPATAN DAN LITERASI KEUANGAN TERHADAP FINANCIAL MANAGEMENT BEHAVIOR (Survei pada Mahasiswa Jurusan Pendidikan Ekonomi Angkatan 2019 Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

NURHAMIDAH, SANTI (2019) PENERAPAN MODEL PROBING PROMPTING LEARNING DENGAN BANTUAN MEDIA POSTER DALAM MENINGKATKAN KEMAMPUAN BERPIKIR KRITIS PESERTA DIDIK (Studi Quasi Eksperimen Mata Pelajaran Ekonomi Kelas XI SMA Negeri 2 Tasikmalaya Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

NURHAYATI, LITA (2021) PENGARUH RETURN ON ASSETS (ROA), FIRM SIZE DAN DEBT TO EQUITY RATIO (DER) TERHADAP NILAI PERUSAHAAN (Survei Pada Perusahaan Food and Beverage Di Bursa Efek Indonesia Tahun 2017-2020). Sarjana thesis, Universitas Siliwangi.

NURHIDAYANTI, HILYA (2021) PENGARUH TOTAL ASSET TURN OVER (TATO), CURRENT RATIO (CR), DAN NET PROFIT MARGIN (NPM) TERHADAP RETURN ON ASSET (ROA) PT. KALBE FARMA Tbk. Sarjana thesis, Universitas Siliwangi.

NURHIKMAT, INDRA (2021) PENGARUH BELANJA MODAL, TINGKAT KEMISKINAN, DAN JUMLAH PENDUDUK TERHADAP INDEKS PEMBANGUNAN MANUSIA KABUPATEN/KOTA DI PROVINSI JAWA BARAT TAHUN 2010-2019. Sarjana thesis, Universitas Siliwangi.

NURIHSAN, AZIZ (2019) ANALISIS PREFERENSI PENGGUNAAN JASA FOTO PREWEDDING DI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

NURJAMAN, FADHILAH CANDRA (2020) PENGARUH MINAT DAN KEBIASAAN BELAJAR TERHADAP PRESTASI BELAJAR PADA PESERTA DIDIK (Survey pada Kelas XI IPS SMA Negeri 6 Kota Tasikmalaya Tahun Ajaran 2019/2020). Sarjana thesis, Universitas Siliwangi.

NURJANAH, AAN (2020) PENGARUH SUKU BUNGA (BI RATE), KUALITAS AKTIVA PRODUKTIF DAN NON PERFORMING LOAN TERHADAP PERTUMBUHAN LABA (Studi Kasus PT. Bank Danamon Indonesia, Tbk.). Sarjana thesis, Universitas Siliwangi.

NURJANAH, D. (2018) PENGARUH PRODUK DOMESTIK BRUTO DAN JUMLAH PENDUDUK TERHADAP KONSUMSI RUMAH TANGGA MASYARAKAT INDONESIA PERIODE 2006-2016. Sarjana thesis, Universitas Siliwangi.

NURJANAH, DEWI (2019) ANALISIS TENAGA KERJA DI INDONESIA TAHUN 2010 (DENGAN MENGGUNAKAN TABEL INPUT-OUTPUT). Sarjana thesis, Universitas Siliwangi.

NURJAYANTI, FITRI FADILA (2021) PENGARUH KOMITMEN, ETOS KERJA DAN DISIPLIN TERHADAP KINERJA KARYAWAN (Suatu Penelitian Pada Karyawan Non Manager PT Sinar Sosro KP. Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

NURLIANA, ALMA (2020) PROSEDUR PEMBUKAAN REKENING TABUNGAN RUPIAH BERBASIS ONLINE PADA PT BANK “X” (PERSERO) TBK. KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

NUROHIM, RIZKI RIMBA (2020) PENGARUH SELEBRITI PENDUKUNG, TAGLINE DAN CITRA MEREK TERHADAP KEPUASAN KONSUMEN (Survey Pada Konsumen Sepatu Brodo). Sarjana thesis, Universitas Siliwangi.

NUROHMAN, ILHAM (2021) PENGARUH CADANGAN DEVISA DAN UTANG LUAR NEGERI TAHUN SEBELUMNYA TERHADAP UTANG LUAR NEGERI PEMERINTAH INDONESIA TAHUN 2011-2020. Sarjana thesis, Universitas Siliwangi.

NURROHMAN, LUTFI ROBBIANA (2022) ANALISIS SISTEM ANTRIAN SEBAGAI UPAYA MENGOPTIMALKAN PELAYANAN TELLER PADA PT. BANK TABUNGAN NEGARA (PERSERO), TBK. CABANG CIAMIS. Sarjana thesis, Universitas Siliwangi.

NURSAFITRI, MONIK (2022) PENGARUH PEMBIAYAAN JUAL BELI DAN PEMBIAYAAN BAGI HASIL TERHADAP PROFITABILITAS DENGAN NON PERFORMING FINANCING (NPF) SEBAGAI VARIABEL INTERVENING (Survei pada Bank Umum Syariah di Indonesia Periode 2016-2020). Sarjana thesis, Universitas Siliwangi.

NURSYIFA, ARIN (2020) ANALISIS PAJAK HOTEL DI KOTA TASIKMALAYA TAHUN 2005-2019. Sarjana thesis, Universitas Siliwangi.

NURUDDIN, YUMNA (2021) PENGARUH NILAI TUKAR, PERTUMBUHAN EKONOMI, DAN PENANAMAN MODAL ASING TERHADAP TOTAL EKSPOR INDONESIA PERIODE 2005-2019. Sarjana thesis, Universitas Siliwangi.

NURZAHRA, SITI PATIMAH (2021) PENGARUH RETURN ON ASSETS (ROA), EARNING PER SHARE (EPS) DAN NET INTEREST MARGIN (NIM) TERHADAP RETURN SAHAM (Survey Pada Emiten Sektor Perbankan Yang Terdaftar di Bursa Efek Indonesia). Sarjana thesis, Universitas Siliwangi.

NUR’AIN, ALIF NABILA (2020) ANALISIS TRANSAKSI NON TUNAI DI INDONESIA. Sarjana thesis, Universitas Siliwangi.

Nabilah, Faza (2021) PENGARUH PENANAMAN MODAL DALAM NEGERI, PENANAMAN MODAL ASING, EKSPOR DAN IMPOR TERHADAP PERTUMBUHAN EKONOMI DI INDONESIA TAHUN 2003-2019. Sarjana thesis, Universitas Siliwangi.

Nafisa, Nisa (2019) PENGARUH MOTIVASI KERJA DAN KOORDINASI PADA UPZ TERHADAP KINERJA BAZNAS KABUPATEN CIAMIS. Sarjana thesis, Universitas Siliwangi.

Nasir, Lutpi (2019) FAKTOR-FAKTOR YANG MEMPERNGARUHI PERMINTAAN KOPI (STUDY KASUS DI KEDAI KOPI FULLHOPPER TASIKMALAYA). Sarjana thesis, Universitas Siliwangi.

Noor Aini, Regita and Badruzaman, Jajang and Hermansyah, Iwan (2020) The Influence of Earnings Response Coefficient (ERC) and Dividend Payout Ratio (DPR) on Stock Price. Hasil Revierwer, 3 (4). pp. 77-84. ISSN 2523-9414 (Print); 2523-6563 (Online)

Nora, Wellem Dian (2015) PENGARUH PENERAPAN PRINSIP-PRINSIP ISLAM DALAM PRODUK BANK DAN KUALITAS PELAYANAN TERHADAP KEPUTUSAN MENJADI NASABAH PT. BANK JABAR BANTEN SYARIAH KCP SINGAPARNA. Sarjana thesis, Universitas Siliwangi.

Novitasari, Asprillia (2021) PENGARUH LITERASI EKONOMI DAN GAYA HIDUP BERBELANJA TERHADAP PEMBELIAN IMPULSIF (Survey pada siswa kelas XI IPS SMA Negeri Se-Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Nugraha, Dendi (2020) PENGARUH RETURN SAHAM DAN KEBIJAKAN DIVIDEN TERHADAP NILAI PERUSAHAAN (Survey Pada Perusahaan Sektor Industri Barang Konsumsi Tahun 2015 - 2018). Sarjana thesis, Universitas Siliwangi.

Nur, Rohmah Rohimah (2020) STRATEGI RESTRUKTURISASI DALAM PENYELAMATAN KREDIT AGUNAN RUMAH (KAR) BERMASALAH PADA PT BANK TABUNGAN NEGARA (PERSERO) Tbk CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Nur Fadilah, Mila (2019) PENGARUH STATUS SOSIAL EKONOMI ORANG TUA TERHADAP SELF-ESTEEM DAN IMPLIKASINYA PADA PRESTASI BELAJAR SISWA SMA NEGERI 10 KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Nur Insani, Anisa (2020) TINJAUAN REALISASI KREDIT USAHA RAKYAT (KUR) PADA NASABAH USAHA MIKRO KECIL MENENGAH (UMKM) PT. BANK NEGARA INDONESIA (PERSERO) Tbk KANTOR CABANG PEMBANTU CIAMIS. Diploma thesis, Universitas Siliwangi.

Nuraeni, Nuni (2022) MEKANISME PEMBERIAN SANTUNAN KORBAN KECELAKAAN LALU LINTAS JALAN PADA JASA RAHARJA PERWAKILAN TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Nuraisyah, Wulan (2020) ANALISIS IMPLEMENTASI PROMOSI MELALUI MEDIA SOSIAL DALAM MENINGKATKAN MINAT PEMBELI (Studi Empiris pada Produk Tutug Oncom Instan Titasix). Sarjana thesis, Universitas Siliwangi.

Nurasifa, Ai (2021) PENGARUH KUALITAS PELAYANAN DAN PROMOSI TERHADAP KEPUTUSAN MENJADI ANGGOTA DENGAN MINAT SEBAGAI VARIABEL INTERVENING (Studi Kasus pada KSPPS BMT Sahabat Kita Semua). Sarjana thesis, Universitas Siliwangi.

Nurdiana, Riza (2020) ANALISIS KEPUTUSAN MEMBAYAR ZAKAT PROFESI PEGAWAI UNIVERSITAS SILIWANGI SKRIPS. Sarjana thesis, Universitas Siliwangi.

Nurdiansyah, Didin (2020) MEKANISME PENGGUNAAN TAPCASH DALAM TRANSAKSI PEMBAYARAN ELEKTRONIK PADA PT. BANK NEGARA INDONESIA (PERSERO), Tbk. KANTOR CABANG PEMBANTU CIAWI TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Nurfadhilah, Salma (2020) PENERAPAN BAURAN PEMASARAN (MARKETING MIX) PADA KREDIT PEMILIKAN RUMAH (KPR) SUBSIDI PADA PT. BANK TABUNGAN NEGARA (PERSERO), TBK KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Nurfadillah, Linda (2022) ANALISIS IMPLEMENTASI AKAD IJARAH PADA BAJU PENGANTIN MUSLIMAH RAIRAKA BRIDE CIAMIS. Sarjana thesis, Universitas Siliwangi.

Nurfalah, Sarah (2019) PENGARUH PEMBERIAN REWARD DAN PUNISHMENT TERHADAP MINAT BELAJAR PESERTA DIDIK PADA MATA PELAJARAN EKONOMI KELAS X IPS SMA NEGERI 7 TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Nurhaliza, Siti (2020) FUNGSI MOTIVASI DAN PENGAWASAN PADA DUNIA USAHA DALAM PERSPEKTIF ISLAM DI PABRIK SANDAL DAN SEPATU ONE LOVE KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Nurhasanah, Ika (2022) ANALISIS DETERMINASI EKSPOR INDUSTRI KREATIF INDONESIA TAHUN 2006-2020. Sarjana thesis, Universitas Siliwangi.

Nurhasanah, Vena Bella (2020) IMPLEMENTASI KEPATUHAN SYARIAH ( SHARIA COMPLIANCE) DALAM OPERASIONAL KOPERASI MINNA LAKA DI PONDOK PESANTREN RIYADLUL ULUM WADDA’WAH CONDONG. Sarjana thesis, Universitas Siliwangi.

Nurhidayat, Naufal (2020) PENGARUH KEMAMPUAN DAN MOTIVASI KERJA TERHADAP KINERJA KARYAWAN DI PT. MULYA JAYA FARM 03. Sarjana thesis, Universitas Siliwangi.

Nurjanah, Silvi Siti (2022) PROSEDUR PEMBERIAN KREDIT PURNA BHAKTI PADA PT BANK PEMBANGUNAN DAERAH JAWA BARAT DAN BANTEN TBK KANTOR CABANG SINGAPARNA. Diploma thesis, Universitas Siliwangi.

Nurjanah, Siti Fatma Rosita (2022) ANALISIS EFEKTIVITAS PROGRAM MICROFINANCE SYARIAH BERBASIS MASYARAKAT (MISYKAT) DALAM MENINGKATKAN USAHA MUSTAHIK PADA MASA PANDEMI COVID -19 (Studi Kasus pada Program Misykat DT.Peduli di Kecamatan Cibeureum Kota Tasikmalaya. Sarjana thesis, Universitas Siliwangi.

Nurlaela, Ela (2020) PROSEDUR PELAKSANAAN KREDIT USAHA MIKRO (KUM) PADA PT. BANK “X” (PERSERO) Tbk. KANTOR CABANG TASIKMALAYA SUTISNA. Diploma thesis, Universitas Siliwangi.

Nurlita, Risa (2019) PENGARUH PEMBERIAN REWARD AND PUNISHMENT SERTA PERSEPSI SISWA TENTANG KOMPETENSI PEDAGOGIK GURU TERHADAP PRESTASI BELAJAR SISWA PADA MATA PELAJARAN EKONOMI (Survey Pada Siswa IPS Kelas X dan XI di Madrasah Aliyah AL-Amin Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Nurmalasari, Dini (2020) ANALISIS ECONOMIC IMPACT ASSESMENT PENGGUNAAN MESIN PARKIR DI KOTA BANDUNG. Sarjana thesis, Universitas Siliwangi.

Nurnawati, Rani (2018) ANALISIS PENGEMBANGAN USAHA KELOMPOK SIMPAN PINJAM PEREMPUAN (SPP) DI UNIT PENGELOLA KEGIATAN (UPK) KECAMATAN JATIWARAS. Sarjana thesis, Universitas Siliwangi.

Nurpadila, Dea (2022) MEKANISME PENYALURAN KREDIT BNI WIRAUSAHA PADA PT. BANK NEGARA INDONESIA (PERSERO) TBK. KANTOR CABANG PEMBANTU SINGAPARNA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Nurrahmi, Shilmi Khalida (2021) EFEKTIVITAS SALURAN DISTRIBUSI DALAM PENINGKATAN VOLUME PENJUALAN DI CV. SUKAHIJAB. Sarjana thesis, Universitas Siliwangi.

Nurul Hidayanti, Maula (2019) PENGARUH KUALITAS PELATIHAN DAN MOTIVASI KERJA TERHADAP KOMPETENSI KARYAWAN DI KSPPS TUNAS ARTHA MANDIRI KANTOR CABANG TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Nurul Khomisah, Enung (2019) PENGARUH PROMOSI, LOKASI, FASILITAS ATM CENTRE DAN LITERASI KEUANGAN TERHADAP KEPUTUSAN NASABAH MENABUNG DI BANK SYARIAH (Studi pada Nasabah Bank Syariah Mandiri Kantor Kas Rancah, Kabupaten Ciamis). Sarjana thesis, Universitas Siliwangi.

Nuryana, Iqbal Anang (2022) PROSEDUR PEMBUKAAN DAN PENUTUPAN TABUNGAN JUARA DI PT. BANK TABUNGAN NEGARA (Persero) Tbk. KANTOR KAS PADAYUNGAN KOTA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Nur’aini, Nunung (2019) ANALISIS STRATEGI FUNDRAISING DALAM MENARIK MINAT MUZAKKI DI LEMBAGA AMIL ZAKAT DOMPET DHUAFA JAWA BARAT. Sarjana thesis, Universitas Siliwangi.

O

OKTAPIANI, INTAN (2021) FAKTOR-FAKTOR YANG MEMPENGARUHI PERTUMBUHAN EKONOMI DI INDONESIA TAHUN 2005-2020. Sarjana thesis, Universitas Siliwangi.

OKTAVIRELA HERMANTO, VIRA (2020) PENGARUH KEPEMIMPINAN DAN DISIPLIN KERJA TERHADAP KINERJA PERAJIN ALAS KAKI (Suatu Penelitian pada Perajin Alas Kaki di CV. BIBELI). Sarjana thesis, Universitas Siliwangi.

P

PAHIRA PANI, HARNI (2019) PENERAPAN MODEL COLLABORATIVE LEARNING MURDER ( MOOD, UNDERSTAND, RECALL, DIGEST, EXPAND, AND REVIEW ) TERHADAP PENINGKATAN PEMAHAMAN KONSEP PESERTA DIDIK (Studi Kuasi Eksperimen Pelajaran Ekonomi Kelas XI IPS SMA Muhammadiyah 1 Tasikmalaya Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

PAMELA, DINDA RIZKA (2020) ANALISIS KETERKAITAN ANTAR SEKTOR, PENGGANDA OUTPUT DAN PENGGANDA PENDAPATAN TERHADAP SEKTOR-SEKTOR UNGGULAN (Data Empirik Input-Output Provinsi Jawa Barat Tahun 2015). Sarjana thesis, Universitas Siliwangi.

PANGESTU, ANGGIT SINGGIH (2020) ANALISIS CITRA MEREK DALAM KEPUTUSAN PEMILIHAN BIRO PERJALANAN HAJI DAN UMROH (STUDI PADA JAMAAH PT. PERSADA AL-AMIN TASIKMALAYA). Sarjana thesis, Universitas Siliwangi.

PANGESTU, RETNO (2021) PENGARUH RETURN ON ASSETS, EARNING PER SHARE, TOTAL ASSETS TURNOVER, DAN DEBT TO EQUITY RATIO TERHADAP RETURN SAHAM (Survei pada Perusahaan Manufaktur yang Go Public di Bursa Efek Indonesia Tahun 2014 – 2019). Pascasarjana thesis, Universitas Siliwangi.

PARTIWI, ANITA MEIDASARI (2022) ANALISIS TINGKAT RISIKO KREDIT MODAL KERJA TERHADAP PELAKU USAHA KECIL DAN MENENGAH PADA PT.BANK TABUNGAN NEGARA (Persero) Tbk KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

PATIMAH, ENENG TITIM SITI (2020) PENGARUH PROFITABILITAS, LIKUIDITAS, OPERATING CASH FLOW DAN FIRM SIZE TERHADAP FINANCIAL DISTRESS (Survei Pada Perusahaan Industri Barang Konsumsi yang Terdaftar Di Bursa Efek Indonesia Periode 2015-2019). Sarjana thesis, Universitas Siliwangi.

PATMAWATI, LUTFI (2021) PENGARUH IKLIM SEKOLAH, PROKRASTINASI AKADEMIK, DAN KEMANDIRIAN BELAJAR TERHADAP HASIL BELAJAR (Survei pada Mata Pelajaran Ekonomi Peserta Didik MAN 3 Kota Tasikmalaya Tahun Ajaran 2020/2021). Sarjana thesis, Universitas Siliwangi.

PEBRIANI, WILDA TRIASTUTI (2020) ANALISIS EFEKTIVITAS DAN KONTRIBUSI PAJAK HOTEL, PAJAK RESTORAN DAN RETRIBUSI OBJEK WISATA TERHADAP PENDAPATAN ASLI DAERAH (PAD) KABUPATEN GARUT TAHUN 2009-2018. Sarjana thesis, Universitas Siliwangi.

PEPI RAHMANI, HANI (2018) PENGARUH KOMPETENSI PROFESIONALISME DAN KOMPETENSI KEPRIBADIAN GURU TERHADAP HASIL BELAJAR SISWA PADA MATA PELAJARAN EKONOMI (Survey Pada Siswa SMA Di Kecamatan Cikatomas Kabupaten Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

PERMADI, ALFI GHIFARI RAYA (2019) PENGARUH LOKASI, FASILITAS FISIK DAN KUALITAS BARANG TERHADAP KEUNGGULAN BERSAING (Survey Pada Karyawan Deden Batik Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

PERMADI, DIAN (2021) ANALISIS PERILAKU INVESTOR MUSLIM MILENIAL DALAM PENGAMBILAN KEPUTUSAN TRANSAKSI SAHAM DI PASAR MODAL. Sarjana thesis, Universitas Siliwangi.

PERMADI, MUHAMAD SALSA (2020) PROSEDUR PELAKSANAAN PEMBERIAN KREDIT UMUM PENSIUN HYBRID PADA PT. BANK WOORI SAUDARA 1906, Tbk KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

PERMADI, NUGRAHA (2019) PENGARUH PRODUKSI PERIKANAN, PENANAMAN MODAL DALAM NEGERI, PENANAMAN MODAL ASING DAN TENAGA KERJA TERHADAP PRODUK DOMESTIK BRUTO SEKTOR PERIKANAN DI INDONESIA TAHUN 2000-2017. Sarjana thesis, Universitas Siliwangi.

PERMANA, YOGA (2019) PENGARUH INVESTASI, TENAGA KERJA, EKSPOR DAN PENGELUARAN KONSUMSI RUMAH TANGGA TERHADAP LAJU PERTUMBUHAN EKONOMI SEKTOR INDUSTRI KABUPATEN GARUT TAHUN 2010 - 2017. Sarjana thesis, Universitas Siliwangi.

PERMATASARI, NURI (2019) PENGARUH KEMANDIRIAN BELAJAR DAN LINGKUNGAN TEMAN SEBAYA TERHADAP HASIL BELAJAR (Penelitian Survey Terhadap Peserta Didik Kelas X dan XI IPS di SMAN 6 Tasikmalaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

PITRIYANI, NOPI (2020) ANALISIS SEKTOR UNGGULAN DI KABUPATEN CIAMIS TAHUN 2011-2018 (Menggunakan Pendekatan Growth And Share). Sarjana thesis, Universitas Siliwangi.

PRAMESTI, SYIFA DWI (2021) PENGARUH CAPITAL ADEQUACY RATIO (CAR), LOAN TO DEPOSIT RATIO (LDR) DAN BIAYA OPERASIONAL PENDAPATAN OPERASIONAL (BOPO) TERHADAP RETURN SAHAM PADA PT BANK NEGARA INDONESIA TBK. Sarjana thesis, Universitas Siliwangi.

PRANA PRISAPAN, ADI (2018) Pengaruh Persepsi Kompetensi Profesional Guru Terhadap Prestasi Belajar Siswa Pada Bidang Studi Kewirausahaan. Sarjana thesis, Universitas Siliwangi.

PRASETYO, BAYU INDRIA (2021) PENGARUH LOKASI, PROMOSI DAN BRAND IMAGE TERHADAP MINAT BELI KONSUMEN DAN DAMPAKNYA TERHADAP KEPUTUSAN PEMBELIAN (Kasus Pada Konsumen CV Subur Jaya Motor Tasikmalaya). Pascasarjana thesis, Universitas Siliwangi.

PRATAMA, FELLIA ANNISA (2021) PENGARUH PENDAPATAN PER KAPITA, TINGKAT KONSUMSI, DAN KURS TERHADAP VOLUME IMPOR GULA INDONESIA TAHUN 2010-2019. Sarjana thesis, Universitas Siliwangi.

PRATAMA, NUGRAHA (2020) IMPLEMENTASI SPONSORSHIP DALAM PEMBENTUKAN BRANDIMAGE PADA PRODUK GAYAQUA DI PT. NATA BERSAUDARA SEJAHTERA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

PRATAMA HARI PUTRA, FAUZIA (2019) PENGARUH PENERAPAN STANDAR OPERASIONAL PROSEDUR DAN PENGENDALIAN KUALITAS TERHADAP KEUNGGULAN BERSAING (Survey pada Distro yang ada di Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

PRATIWI, FARHANA TRESNAWATI (2021) ANALISIS DAMPAK PANDEMI COVID-19 TERHADAP SEKTOR PERDAGANGAN, PARIWISATA DAN KEUANGAN MONETER DI INDONESIA. Sarjana thesis, Universitas Siliwangi.

PRATIWI, GINA RAHMA (2020) PROSEDUR HANDLING COMPLAINT DALAM SERVICE EXCELLENT PADA NASABAH DI PT. BANK NEGARA INDONESIA (Persero) Tbk. Diploma thesis, Universitas Siliwangi.

PRATIWI, PRATIWI SITI PATIMAH (2020) PENGARUH INTEREST BASED INCOME DAN FEE BASED INCOME TERHADAP PROFITABILITAS (Sensus Pada Perusahaan Perbankan Konvensional yang terdaftar di Bursa Efek Indonesia). Sarjana thesis, Universitas Siliwangi.

PRATIWI, SITI NURLAILA (2021) PENGARUH EFIKASI DIRI, PENGGUNAAN MEDIA SOSIAL DAN LINGKUNGAN KELUARGA TERHADAP INTENSI BERWIRAUSAHA SISWA (Survey pada Peserta Didik Kelas XI SMA Negeri 9 Tasikmalaya Tahun Ajaran 2020/2021). Sarjana thesis, Universitas Siliwangi.

PRATIWY, ASTRY (2020) PENGARUH LUAS LAHAN DAN TENAGA KERJA TERHADAP PRODUKSI KELAPA SAWIT INDONESIA TAHUN 2013-2017. Sarjana thesis, Universitas Siliwangi.

PRIANTO, RIAN (2021) PENGARUH KECERDASAN EMOSIONAL DAN KEPERCAYAAN DIRI TERHADAP MINAT BELAJAR MAHASISWA DAN IMPLIKASINYA PADA PRESTASI BELAJAR (Survey Pada Mahasiswa Jurusan Pendidikan Ekonomi Fakultas Keguruan dan Ilmu Pendidikan Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

PRIOCTAVIA, DWITA (2020) ANALISIS UMKM: BUKTI EMPIRIS PRODUK MAKANAN RINGAN DI KABUPATEN CILACAP. Sarjana thesis, Universitas Siliwangi.

PRIYADI, RD. NIZAR AZHARI (2021) PENGARUH MOTIVASI, GAYA HIDUP, DAN STATUS SOSIAL EKONOMI TERHADAP PERILAKU KONSUMTIF MAHASISWA (Survei pada Mahasiswa Pendidikan Ekonomi Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

PUJIANTARA, DIAN (2019) ANALISIS VOLUME IMPOR DAGING SAPI DI INDONESIA TAHUN 2000-2018. Sarjana thesis, Universitas Siliwangi.

PURNAMA, BAYU (2020) ANALISIS DAMPAK PEMEKARAN KABUPATEN CIAMIS TERHADAP PERKEMBANGAN SOSIAL EKONOMI DAN KINERJA KEUANGAN PEMERINTAHAN DAERAH. Sarjana thesis, Universitas Siliwangi.

PUTRA, ABDUL JABBAR LAKSANA (2022) PENGARUH STABILITAS POLITIK, KORUPSI, INDEKS KEBEBASAN EKONOMI, DAN PERTUMBUHAN PENDUDUK TERHADAP PERTUMBUHAN EKONOMI DI ASEAN-5 TAHUN 2014-2019. Sarjana thesis, Universitas Siliwangi.

PUTRI, AMANDA MAULIDA (2020) ANALISIS TINGKAT PENGANGGURAN DI PERKOTAAN PROVINSI JAWA BARAT PERIODE 2014-2018. Sarjana thesis, Universitas Siliwangi.

PUTRI, FITRIA DIANA (2020) ANALISIS DETERMINAN REMUNERASI DIREKSI (Survei pada Perbankan Umum Konvensional yang terdaftar di Bursa Efek Indonesia dan Otoritas Jasa Keuangan Periode 2016-2018). Sarjana thesis, Universitas Siliwangi.

PUTRI, REFI MELATI (2020) ANALISIS FAKTOR YANG MEMPENGARUHI PENYERAPAN TENAGA KERJA PADA INDUSTRI ANYAMAN PANDAN DI KECAMATAN RAJAPOLAH. Sarjana thesis, Universitas Siliwangi.

PUTRI, SUCI DESTI (2022) PENGARUH MODAL, TENAGA KERJA, PENDIDIKAN, DAN LAMA USAHA TERHADAP OMSET PENJUALAN (Sensus pada UMKM Kerajinan Anyam Pandan di Kampung Kreatif Sukaruas Desa Sukaraja Kecamatan Rajapolah. Sarjana thesis, Universitas Siliwangi.

PUTRI, VIVIANA SARI KURNIA (2020) POTENSI KEBANGKRUTAN PADA INDUSTRI RITEL YANG TERDAFTAR DI BURSA EFEK INDONESIA. Sarjana thesis, Universitas Siliwangi.

PUTRIYANI, NUR (2022) PENGARUH UPAH DAN LINGKUNGAN KERJA TERHADAP KINERJA KARYAWAN FEEDER DI CV. DUNAN PRATAMA KECAMATAN CIPATUJAH KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Padilah, Cepi Patwa (2018) PENGARUH STRES KERJA TERHADAP KINERJA KARYAWAN (Suatu Penelitian Pada Karyawan Pembayaran dan Pelayanan Administrasi Bank Indonesia Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Parulian, Andreas (2021) ANALISIS FAKTOR – FAKTOR YANG MEMPENGARUHI DAYA SAING USAHA BAKSO FIRMAN DI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Pebriyani, Riyas (2020) PROSEDUR PEMBUKAAN DEPOSITO MANTAP PADA PT. BANK MANDIRI TASPEN KANTOR KAS CIAMIS. Diploma thesis, Universitas Siliwangi.

Permatsari, Dewi and Sahroni, Nana (2022) PENGARUH RETURN ON EQUITY DAN CURRENT RATIO TERHADAP KEBIJAKAN DIVIDEN PADA PT. ASTRA INTERNASIONAL TBK. Repositori Universitas Siliwangi. pp. 1-25.

Pirmansah, M. Haris (2019) PENGARUH FASILITAS BELAJAR DAN MOTIVASI BELAJAR TERHADAP PRESTASI BELAJAR SISWA (Survei pada Siswa Kelas X IPS SMAN 1 Ciawi Kabupaten Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Prabowo, Martin (2020) ANALISIS PERAN DAN FUNGSI DEWAN PENGAWAS SYARIAH DALAM SHARIA COMPLIANCE DI BMT AL-ITTIHAD CIKURUBUK TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Prabowo, Martin (2020) ANALISIS PERAN DAN FUNGSI DEWAN PENGAWAS SYARIAH DALAM SHARIA COMPLIANCE DI BMT AL-ITTIHAD CIKURUBUK TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Prajwalita Cahyani, Regina (2019) PENGARUH PENGALAMAN BERORGANISASI INTERN TERHADAP PENGEMBANGAN SOFT SKILL (Survei pada Mahasiswa Jurusan Pendidikan Ekonomi Universitas Siliwangi Angkatan 2016 dan 2017). Sarjana thesis, Universitas Siliwangi.

Pramitasari, Lydia (2021) PENGARUH SELEBGRAM ENDORSMENT TERHADAP MINAT BELI KONSUMEN DENGAN KEPERCAYAAN SEBAGAI VARIABEL INTERVENING (Studi Kasus Pada Produk Pakaian Muslimah Kalisha). Sarjana thesis, Universitas Siliwangi.

Pramodya, Sinta (2019) PENGARUH TINGKAT SUKU BUNGA DAN VOLUME PENJUALAN SAHAM TERHADAP HARGA SAHAM (Penelitian pada PT. XL Axiata Tbk). Sarjana thesis, Universitas Siliwangi.

Pratama, Riki (2022) ANALISIS KINERJA KEUANGAN PADA KSPPS BMT AL-BINA KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Pratama, Rio (2021) STUDI KOMPARASI EFEKTIVITAS PENJUALAN SISTEM KONSINYASI OFFLINE DENGAN ONLINE DI PERUSAHAAN BIDO COLLECTIONS TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Pratama Oktaviana Rahman, Satiya (2018) PENGARUH LINGKUNGAN KERJA DAN TATA LETAK FASILITAS PABRIK TERHADAP PRODUKTIVITAS KARYAWAN (Survei pada Karyawan Bagian Produksi di CV. Bastoh Tasikmalaya). Sarjana thesis, UNIVERSITAS SILIWANGI.

Pratiwi, Suciani Lugina (2019) PENGARUH NON PERFORMING FINANCE TERHADAP LIKUIDITAS BANK JABAR BANTEN SYARIAH KCP GARUT PERIODE 2016 - 2018. Sarjana thesis, Universitas Siliwangi.

Pratiwi Haryono, Putriani (2019) PENERAPAN MODEL PEMBELAJARAN PROJECT BASED LEARNING UNTUK MENINGKATKAN KEMAMPUAN BERPIKIR KREATIF PESERTA DIDIK (Studi Kuasi Eksperimen Pada Mata Pelajaran Prakarya danKewirausahaanKelas XI IPA SMA Negeri 1 Ciawi Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Purnamasari, Dwi (2022) STRATEGI PENGEMBANGAN PASAR TRADISIONAL PADAYUNGAN BERBASIS EKONOMI UMAT DI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Purnamasari, Restu (2019) PENERAPAN MODEL PEMBELAJARAN KOOPERATIF TIPE MAKE A MATCH DALAM MENINGKATKAN HASIL BELAJAR SISWA (Studi Quasi Eksperimen Pada Mata Pelajaran Ekonomi Kelas X IPS MAS Cilendek Kota Tasikmalaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

Puspita, Nafa (2019) PENERAPAN MODEL PEMBELAJARAN ROLE PLAYING DENGAN MENGGUNAKAN ALAT PERAGA UNTUK MENINGKATKAN KEMAMPUAN PEMAHAMAN SISWA (Studi Eksperimen Pada Mata Pelajaran Ekonomi Kelas X IIS MAN 3 Kota Tasikmalaya Tahun Pelajaran 2018/ 2019). Sarjana thesis, Universitas Siliwangi.

Putra, Arfan Yuliant (2021) ANALISIS DETERMINAN DEFISIT ANGGARAN DAN PENGARUHNYA TERHADAP UTANG LUAR NEGERI INDONESIA TAHUN 2006-2018. Sarjana thesis, Universitas Siliwangi.

Putra, Toni Hadi (2018) PENGARUH KUALITAS PRODUK, HARGA DAN DISTRIBUSI TERHADAP KEPUTUSAN PEMBELIAN PRODUK MAKANAN OLAHAN BEKU (Survey pada Konsumen CV. Riel Us di Tasikmalaya. Pascasarjana thesis, Universitas Siliwangi.

Putri, Chantyka Dykyany (2020) ANALISIS KEPUASAN MUSTAHIK ZAKAT PADA PROGRAM MISYKAT DT PEDULI (Studi Pada Majelis Misykat Al-Huda Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Putri, Maura Flagelia (2021) ANALISIS STRATEGI BAURAN PEMASARAN TOKO HAVANA FROZEN FOOD KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Putri Setiawan, Regita (2020) PENERAPAN STRATEGI PEMASARAN SIMPANAN DEPOSITO BERJANGKA RUPIAH PADA PT. BANK NEGARA INDONESIA (PERSERO) Tbk. KANTOR CABANG PEMBANTU CIAMIS. Diploma thesis, Universitas Siliwangi.

R

RACHMAWATI, DESY (2019) ANALISIS PENDAPATAN ASLI DESA (PADesa) DAN ALOKASI DANA DESA (ADD) SERTA DAMPAKNYA TERHADAP BELANJA DESA (Studi Kasus Pada Desa-Desa Di Kecamatan Cimaragas Tahun 2015-2017). Sarjana thesis, Universitas Siliwangi.

RAHAYU, FAJAR (2019) ANALISIS PENGARUH JUMLAH EMITEN, KURS, SUKU BUNGA DEPOSITO DAN LAJU INFLASI TERHADAP INDEKS HARGA SAHAM SEKTOR KEUANGAN DI BURSA EFEK INDONESIA TAHUN 2003-2018. Sarjana thesis, Universitas Siliwangi.

RAHAYU, PANJI YUGA (2020) PENGARUH DISIPLIN KERJA, MOTIVASI KERJA DAN BUDAYA ORGANISASI TERHADAP KINERJA KARYAWAN (Suatu Penelitian Pada Karyawan Bagian Pelaksana Badan Pengelola Keuangan dan Aset Daerah Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

RAHAYU, REGA DESTIANI (2019) PENERAPAN MODEL PEMBELAJARAN KOOPERATIF TIPE TEAMS GAMES TOURNAMENT (TGT) DALAM MENINGKATKAN PRESTASI BELAJAR SISWA (Studi Kuasi Eksperimen pada kelas X IIS Tahun pelajaran 2018/ 2019 MAN 2 Kabupaten Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

RAHAYU, SHILVIA SHINTA (2021) ANALISIS IMPLEMENTASI PRINSIP GOOD CORPORATE GOVERNANCE (GCG) DALAM DISTRIBUSI ZAKAT DI BAZNAS KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

RAHAYU NINGRUM, ASRI (2019) KOORDINASI, EVALUASI KERJA DAN SPIRITUALITAS DI TEMPAT KERJA SEBAGAI FAKTOR PENENTU TERHADAP KINERJA PEGAWAI (Survey Pada Pegawai Puskesmas Di Wilayah Kota Tasikmalaya). Pascasarjana thesis, Universitas Siliwangi.

RAHAYUNINGTIAS, AJENG DWI (2020) PROSEDUR PEMBUKAAN DAN PENUTUPAN MANDIRI DEPOSITO SECARA OFFLINE DAN ONLINE PADA PT. BANK “X” (Persero) Tbk. KANTOR AREA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

RAHMA, FAHMI AUPA (2022) PENGARUH LINGKUNGAN KERJA, BUDAYA KERJA, DAN DISIPLIN KERJA TERHADAP KINERJA KARYAWAN (Suatu Penelitian Pada Karyawan Bagian Tata Usaha Rumah Sakit Umum daerah dr Soekardjo Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

RAHMA FADLILAH, VILIA (2019) ANALISIS PERMINTAAN BAWANG MERAH (Studi Kasus di Kecamatan Cibeurueum Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

RAHMAH, MELA FAUZIAH (2020) ANALISIS PERAN MANAJER DALAM PENANGANAN PEMBIAYAAN BERMASALAH PADA AKAD MUDHARABAH DI KOPERASI BMT DANA UKHUWAH CICALENGKA. Sarjana thesis, Universitas Siliwangi.

RAHMAH, PUTRI DAFFA AZIZAH (2022) FAKTOR-FAKTOR YANG MEMPENGARUHI OMZET PENGUSAHA KONVEKSI FASHION DI KECAMATAN TAMANSARI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

RAHMAN, ANUARI RAMANDIKA (2021) PENGARUH BIAYA KUALITAS DAN BIAYA PEMELIHARAAN TERHADAP LABA OPERASIONAL PERUSAHAAN (Studi Kasus pada CV. Garnis Mandiri Periode 2014-2019). Sarjana thesis, Universitas Siliwangi.

RAHMAN, BOBBY (2020) PROSEDUR PENCAIRAN KLAIM ASURANSI KECELAKAAN ANGKUTAN UMUM PADA PT. JASA RAHARJA (PERSERO) KANTOR PERWAKILAN TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

RAHMANI, HILDA PARAMITA (2020) MEKANISME PENGARSIPAN DOKUMEN KREDIT PEMILIKAN RUMAH (KPR) SUBSIDI PADA PT. BANK TABUNGAN NEGARA (PERSERO) Tbk. KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

RAHMANSYAH, ALDI RAMDHAN (2021) ANALISIS KINERJA KEUANGAN PEMERINTAH DAERAH KOTA BEKASI TAHUN 2010 - 2020. Sarjana thesis, Universitas Siliwangi.

RAHMATILAH, RAHMATILAH (2019) PENGARUH STATUS SOSIAL EKONOMI ORANG TUA DAN PRESTASI BELAJAR MAHASISWA TERHADAP MINAT MENJADI GURU EKONOMI (Survey Pada Mahasiswa Jurusan Pendidikan Ekonomi Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

RAHMATILLAH, AI (2019) PENGARUH KEMISKINAN, PERTUMBUHAN EKONOMI, BELANJA MODAL DAN PERTUMBUHAN PENDUDUK TERHADAP INDEKS PEMBANGUNAN MANUSIA DI JAWA BARAT TAHUN 2008-2017. Sarjana thesis, Universitas Siliwangi.

RAHMAWAN, OKA (2019) PENGARUH KREATIVITAS GURU DALAM MENGELOLA PROSES PEMBELAJARAN TERHADAP MINAT BELAJAR SISWA (Penelitian Survey Terhadap Siswa Kelas XII IPS Pada Mata Pelajaran Ekonomi di SMA Islam Cipasung Tahun Pelajaran 2019/2020). Sarjana thesis, Universitas Siliwangi.

RAHMAWATI, FADILAH (2020) PENGARUH TINGKAT PENDIDIKAN, UPAH MINIMUM REGIONAL, INFLASI DAN ANGKATAN KERJA TERHADAP TINGKAT PENGANGGURAN DI KOTA TASIKMALAYA PERIODE 2004-2018. Sarjana thesis, Universitas Siliwangi.

RAHMAWATI, GALUH (2022) PROSEDUR PEMBERIAN KREDIT USAHA RAKYAT (KUR) MIKRO PADA PT. BANK RAKYAT INDONESIA (PERSERO) TBK. UNIT SINDANGKASIH CABANG CIAMIS. Diploma thesis, Universitas Siliwangi.

RAHMAWATI, MAYA (2020) PENGARUH TINGKAT DANA ALOKASI UMUM (DAU) DAN TINGKAT DANA ALOKASI KHUSUS (DAK) TERHADAP DESENTRALISASI FISKAL (Studi Kasus pada Pemerintahan Kota Tasikmalaya Tahun 2007-2016). Sarjana thesis, Universitas Siliwangi.

RAHMAWATI, RAHMAWATI (2019) ANALISIS PENERAPAN AKUNTANSI SYARIAH BERDASARKAN PSAK NOMOR. 102 PADA PEMBIAYAAN MURABAHAH DI BMT AL-ITTIHAD CIKURUBUK TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

RAHMAWATI, RISKA (2019) PENGARUH GAJI DAN TUNJANGAN TERHADAP KINERJA KARYAWAN (Study Kasus Pada Karyawan Bagian Penjualan di PT. Rizki Teknik Utama). Sarjana thesis, Universitas Siliwangi.

RAHMAWATI, SRI SINTA (2022) PENGARUH PENDIDIKAN, TINGKAT PENGANGGURAN TERBUKA, DAN PERTUMBUHAN EKONOMI TERHADAP JUMLAH PENDUDUK MISKIN DI PROVINSI JAWA BARAT TAHUN 2002-2020. Sarjana thesis, Universitas Siliwangi.

RAHMAYANTI, RISMA (2020) PENGARUH SELF REGULATED LEARNING, LINGKUNGAN KELUARGA DAN IKLIM KELAS TERHADAP PRESTASI BELAJAR PADA MATA PELAJARAN EKONOMI (Survei pada Siswa Kelas XI IPS SMA Negeri Se-Kota Tasikmalaya Tahun Ajaran 2019/2020). Sarjana thesis, Universitas Siliwangi.

RAHMAYATI, FRIDA (2020) PENGARUH PENDIDIKAN KEWIRAUSAHAAN, EFIKASI DIRI DAN NORMA SUBJEKTIF TERHADAP INTENSI BERWIRAUSAHA PADA MAHASISWA JURUSAN MANAJEMEN ANGKATAN 2017 FAKULTAS EKONOMI UNIVERSITAS SILIWANGI. Sarjana thesis, Universitas Siliwangi.

RAMADAN, PANI (2016) PENGARUH BIAYA PENGEMBANGAN PRODUK TERHADAP PENINGAKATAN VOLUME PENJUALAN PADA HOME INDUSTRI KELOM GEULIS SHENY KOTA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

RAMADANI, ASIPA SITI (2021) FAKTOR YANG MEMPENGARUHI KEPUTUSAN PEMBELIAN MOBIL PRIBADI DI KECAMATAN PANUMBANGAN KABUPATEN CIAMIS. Sarjana thesis, Universitas Siliwangi.

RAMADANI, MUHAMAD HASAN MULYASA (2021) PENGARUH CORPORATE SOCIAL RESPONSIBILITY DAN KEPEMILIKAN MANAJERIAL TERHADAP NILAI PERUSAHAAN DENGAN PROFITABILITAS DAN UKURAN PERUSAHAAN SEBAGAI VARIABEL MODERASI (Pada Perusahaan Pertambangan Sub Sektor Minyak dan Gas Bumi di Bursa Efek Indonesia). Sarjana thesis, Universitas Siliwangi.

RAMADANTY, INDRI NURUL (2020) PENGARUH PENGETAHUAN KEWIRAUSAHAAN DAN LINGKUNGAN KELUARGA TERHADAP MINAT BERWIRAUSAHA PADA MAHASISWA JURUSAN PENDIDIKAN EKONOMI (Studi Survei Pada Mahasiswa Jurusan Pendidikan Ekonomi Angkatan 2016 dan 2017 di Universitas Siliwangi Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

RAMADHANTY, EVANI THUFAILAH (2021) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI IMPOR DAGING SAPI POTONG DI INDONESIA TAHUN 2000-2019. Sarjana thesis, Universitas Siliwangi.

RAMDAN AZHARI, ARIF (2019) DETERMINAN PERTUMBUHAN PENYERAPAN TENAGA KERJA PADA SEKTOR INDUSTRI MANUFAKTUR DI JAWA BARAT TAHUN 2005-2018. Sarjana thesis, Universitas Siliwangi.

RAMDANI, ARI (2019) ANALISIS LIMA NEGARA TUJUAN EKSPOR KARET INDONESIA TAHUN 2013-2017. Sarjana thesis, Universitas Siliwangi.

RAMDANI, PITRA (2020) ANALISIS PENDAPATAN PETANI KOPI STUDI KASUS DI KAMPUNG KIARA BONGKOK DESA PUSPAMUKTI KECAMATAN CIGALONTANG KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

RATNASARI WIKARYO, FRANSISKA (2016) ANALISIS PERBANDINGAN ABNORMAL RETURN DAN TRADING VOLUME ACTIVITY SEBELUM DAN SETELAH PENGUMUMAN RIGHT ISSUE DI BURSA EFEK INDONESIA (Sensus Pada Perusahaan Yang Melakukan Right Issue Tahun 2014). Sarjana thesis, Universitas Siliwangi.

REGISTA M, SISTA (2020) PENGARUH PEMBIAYAAN BERMASALAH DAN EFISIENSI OPERASIONAL TERHADAP PERTUMBUHAN LABA OPERASI (Sensus pada Bank Umum Syariah yang Terdaftar di Otoritas Jasa Keuangan Tahun 2015-2018). Sarjana thesis, Universitas Siliwangi.

REHANA, OKKEU MUTIARA (2020) PENGARUH RETURN SAHAM TERHADAP VOLUME PERDAGANGAN SAHAM (Pada PT. Indofood CBP Sukses Makmur, Tbk). Sarjana thesis, Universitas Siliwangi.

RENALDY, RENALDY (2020) GARUH KREDIT LIKUIDITAS BANK INDONESIA DAN TINGKAT SUKU BUNGA PASAR UANG ANTAR BANK TERHADAP VOLUME TRANSAKSI PASAR UANG ANTAR BANK DI INDONESIA PERIODE TAHUN 2008-2018. Sarjana thesis, Universitas Siliwangi.

RESTI, DEVI (2022) ANALISIS PENERAPAN SISTEM DIGITAL MARKETING BERBASIS SOSIAL MEDIA DALAM MENINGKATKAN PENDAPATAN PETANI BUAH SAWO KAMPUNG PASIR GANAS. Sarjana thesis, Universitas Siliwangi.

REVINA, WHIKI (2022) PENGARUH UKURAN PERUSAHAAN, SOLVABILITAS DAN PROFITABILITAS TERHADAP LAMANYA WAKTU PENYELESAIAN AUDIT (AUDIT DELAY) (Studi Pada Perusahaan Manufaktur Yang Terdaftar Di Bursa Efek Indonesia Tahun 2015-2019). Sarjana thesis, Universitas Siliwangi.

RHAMADHAN, GILANG (2021) ANALISIS PENGARUH JUMLAH PENDUDUK, PDRB DAN INFLASI TERHADAP PENDAPATAN ASLI DAERAH (PAD) SETIAP PROVINSI DI INDONESIA TAHUN 2010-2019. Sarjana thesis, Universitas Siliwangi.

RIDWAN, RIDWAN (2021) PEMBERDAYAAN MASYARAKAT MELALUI PENGELOLAAN PUPUK ORGANIK DALAM MENINGKATKAN KESEJAHTERAAN EKONOMI KELUARGA (Studi di Desa Pamokolan, Kecamatan Cihaurbeuti, Kabupaten Ciamis). Sarjana thesis, Universitas Siliwangi.

RIFALDI, FILZA (2019) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI PENDAPATAN NELAYAN DI KECAMATAN PANGANDARAN KABUPATEN PANGANDARAN. Sarjana thesis, Universitas Siliwangi.

RIFQI, MUHAMMAD (2020) ANALISIS PERMINTAAN LIQUID ROKOK ELEKTRIK EMKAY BREWERY DI KOTA TASIKMALAYA SKRI. Sarjana thesis, Universitas Siliwangi.

RINDIYANTI, PUPUT (2019) PENERAPAN MODEL PEMBELAJARAN PROBLEM SOLVING DENGAN BANTUAN MEDIA VISUAL DALAM MENINGKATKAN KEMAMPUAN BERPIKIR KRITIS SISWA (Studi Quasi Eksperimen Pada Mata Pelajaran Ekonomi Kelas XI IPS SMA Negeri 1 Jatiwaras). Sarjana thesis, Universitas Siliwangi.

RISDAWANTY, RISDAWANTY (2022) PENGARUH MEDIA SOSIAL, PERSONAL SELLING DAN PROMOSI PENJUALAN TERHADAP MINAT BELI PRODUK ORIFLAME (Survey Pada Mahasiswa STIE Latifah Mubarokiyah Suryalaya ). Pascasarjana thesis, Universitas Siliwangi.

RISKA SOPIYANTI, FEMMY (2020) ANALISIS KUNJUNGAN WISATAWAN KE PANTAI PANGANDARAN KABUPATEN PANGANDARAN. Sarjana thesis, Universitas Siliwangi.

RISMALISA, KARINA KHASIDA (2020) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI MIGRASI PENDUDUK MASUK KE PROVINSI DKI JAKARTA. Sarjana thesis, Universitas Siliwangi.

RISMAYA, DEWI INTEN (2021) PENGARUH RETURN ON EQUITY (ROE), EARNING PER SHARE (EPS) DAN NET PROFIT MARGIN (NPM) TERHADAP RETURN SAHAM (Survey Pada Sektor Industri Barang dan Konsumsi yang Terdaftar di Bursa Efek Indonesia Periode 2017-2019). Sarjana thesis, Universitas Siliwangi.

RIYADI, ELFAN PRIANDITA (2020) PENGARUH GOOD CORPORATE GOVERNANCE DAN CORPORATE SOCIAL RESPONSIBILITY TERHADAP KINERJA KEUANGAN PERUSAHAAN (Survei pada Perusahaan Emiten Mitra IICG tahun 2014-2018). Sarjana thesis, Universitas Siliwangi.

RIZAL FIRDAUS, MOCHAMAD (2020) PROSEDUR PENYELESAIAN PINJAMAN BERMASALAH DI KOPERASI SIMPAN PINJAM SIMPENAN PAMEUNGKEUT BANDA (KSP SPB) TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

RIZFAN, MOHAMAD (2020) ANALISIS PERBANDINGAN RETURN ON INVESTMENT (ROI) DAN ECONOMIC VALUE ADDED (EVA) SEBAGAI ALAT UKUR PENILAIAN KINERJA KEUANGAN (Studi Pada P.T. Waskita Karya Tbk.). Sarjana thesis, Universitas Siliwangi.

RIZKI, DONI NUR (2022) PROSEDUR PEMBUKAAN REKENING TABUNGAN RENCANA PENDIDIKAN iB MASLAHAH DENGAN PRINSIP AKAD MUDHARABAH MUTLAQAH PADA PT. BANK JABAR BANTEN SYARIAH (PERSERO), Tbk. KANTOR CABANG PEMBANTU SINGAPARNA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

RIZKIANSYAH, GIBRAN ALFIANTO (2020) PENGARUH TINGKAT INFLASI DAN PDRB TERHADAP UPAH MINIMUM PROVINSI (UMP) DKI JAKARTA PERIODE 2012 - 2019. Sarjana thesis, Universitas Siliwangi.

RIZKIANSYAH, GIBRAN ALFIANTO (2021) PENGARUH TINGKAT INFLASI DAN PDRB TERHADAP UPAH MINIMUM PROVINSI (UMP) DKI JAKARTA PERIODE 2012 - 2019. Sarjana thesis, Universitas Siliwangi.

RIZWAN, ARIZ (2020) PENGARUH SELEBRITI PENDUKUNG DAN TAGLINE TERHADAP KEPUTUSAN PEMBELIAN (Survey Pada Konsumen Sepatu Ventela). Sarjana thesis, Universitas Siliwangi.

ROKIB, AHMAD (2021) ANALISIS PENERAPAN PSAK 109 DALAM MENYUSUN LAPORAN KEUANGAN DI BAZNAS KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

ROMANSYAH S, MUHAMAD TAOFIQ (2020) PENGARUH BELANJA DAERAH, INVESTASI DAN TENAGA KERJA TERHADAP PDRB SERTA DAMPAKNYA TERHADAP PAD KABUPATEN GARUT TAHUN 2010-2019. Sarjana thesis, Universitas Siliwangi.

ROSADI, RIYAD RIANSYAH (2021) PENGARUH PENDAPATAN ASLI DAERAH TERHADAP KEMANDIRIAN KEUANGAN DAERAH (Studi kasus pada Pemerintah Daerah Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

ROSDIANA, ROSDIANA (2020) ANALISIS INDEKS PEMBANGUNAN MANUSIA (IPM) DI PERKOTAAN JAWA BARAT PERIODE 2014-2018. Sarjana thesis, Universitas Siliwangi.

ROSIDA, IDA (2020) ANALISIS STRATEGI PENANGANAN AGENCY PROBLEM PADA PEMBIAYAAN MUDHARABAH DI BMT SAHABAT MANGKUBUMI TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

ROSLINAWATI, . (2019) PENGARUH MODAL, BAHAN BAKU DAN TENAGA KERJA TERHADAP PRODUKSI PAKAIAN BORDIR KOMPUTER DI DESA SUKAMENAK KECAMATAN SUKARAME KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

RUHYADI, RUHYADI (2020) ANALISIS STRATEGI BERSAING PERUSAHAAN BIDO COLLECTIONS KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

RUSDIANA, NANA (2021) PENGARUH RETURN ON ASSETS (ROA), RETURN ON EQUITY (ROE), BI RATE, DAN NILAI TUKAR TERHADAP HARGA SAHAM PT BANK CENTRAL ASIA TBK DI BURSA EFEK INDONESIA TAHUN 2005-2019. Sarjana thesis, Universitas Siliwangi.

RUSMIATI, FITRI (2020) PENGARUH KUALITAS PELAYANAN DAN BIAYA IJARAH TERHADAP KEPUTUSAN NASABAH PADA PRODUK GADAI SYARIAH DI PEGADAIAN SYARIAH CPS PADAYUNGAN KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

RYAN, MUHAMMAD RAMADHAN (2019) PENGARUH KUALITAS PELAYANAN DAN FASILITAS BANK TERHADAP KEPUTUSAN MENJADI NASABAH PENABUNG DI PT BANK BJB SYARIAH KANTOR KAS JASA KARTINI TASIKMALAYA. Sarjana thesis, universitas siliwangi.

Rachman, Rusyidi (2019) PENGARUH LITERASI EKONOMI DAN MODERNITAS TERHADAP PERILAKU KONSUMTIF MAHASISWA PENDIDIKAN EKONOMI (Survei Pada Mahasiswa Pendidikan Ekonomi Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

Rahayu, Rian Muhamad (2020) PERAN INFRASTRUKTUR DALAM PEMBANGUNAN SEKTOR PERTANIAN PROVINSI JAWA BARAT TAHUN 2006-2017 (Studi kasus terhadap pertanian subsektor perkebunan, tanaman bahan makanan dan perikanan air tawar). Sarjana thesis, Universitas Siliwangi.

Rahma, Gilian Nazla (2021) ANALISIS STRATEGI PENGEMBANGAN BISNIS KONVEKSI MUNAZH COLLECTION. Sarjana thesis, Universitas Siliwangi.

Rahmatullah AR, Decky (2019) ANALISIS PERILAKU PRODUKSI ISLAMI PADA MAKANAN KEMASAN DI INDUSTRI RUMAH TANGGA DESA RAWA KECAMATAN CINGAMBUL KABUPATEN MAJALENGKA. Sarjana thesis, Universitas Siliwangi.

Rahmawati, Ika (2020) PENGARUH GAYA KEPEMIMPINAN DAN LINGKUNGAN KERJA TERHADAP KINERJA KARYAWAN DI BANK BRI SYARIAH KANTOR CABANG TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Rahmawati, Pipit (2019) IMPLEMENTASI AKAD MUZARAAH PADA TANAH WAKAF DI DKM BAITURROHIM, DUSUN BOJONGGENTENG, DESA KERTAJAYA, KECAMATAN MANGUNJAYA, KABUPATEN PANGANDARAN. Sarjana thesis, Universitas Siliwangi.

Ramadan, Dwi Rahmawati (2021) ANALISIS KEPUTUSAN NASABAH DALAM PEMILIHAN PRODUK TABUNGAN BSI EASY WADIAH DAN BSI EASY MUDHARABAH (Studi Kasus pada Bank Syariah Indonesia KCP CIlacap Diponegoro). Sarjana thesis, Universitas Siliwangi.

Ramadhan, Fajar (2019) ANALISIS PEMAHAMAN PETANI TENTANG ZAKAT PERTANIAN DI DESA CIAMPANAN KECAMATAN CINEAM KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Ramadhanti, Alyssa Fatma (2022) ANALISIS STANDAR OPERASIONAL PROSEDUR (SOP) PEMBERIAN KREDIT USAHA RAKYAT (KUR) PADA PT BANK NEGARA INDONESIA (PERSERO) TBK. KANTOR CABANG PEMBANTU SINGAPARNA. Diploma thesis, Universitas Siliwangi.

Ramdaniyati, Rani (2019) PENGARUH E-COMMERCE DAN GAYA HIDUP TERHADAP PERILAKU KONSUMTIF MAHASISWA PENDIDIKAN EKONOMI FAKULTAS KEGURUAN DAN ILMU PENDIDIKAN UNIVERSITAS SILIWANGI. Sarjana thesis, Universitas Siliwangi.

Ramdhani, Rifkie Maulana (2022) ANALISIS KEBERLANJUTAN PROGRAM PEMBERDAYAAN EKONOMI LUMBUNG TERNAK WAKAF AKSI CEPAT TANGGAP TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Rani Rohmah, Siti (2019) IMPLEMENTASI PENDAMPINGAN DALAM PEMBERDAYAAN EKONOMI PADA PROGRAM MISYKAT DT PEDULI PRIANGAN TIMUR. Sarjana thesis, Universitas Siliwangi.

Rasetyo, Dhimas Tiyan (2022) STRATEGI PENAGIHAN KEPADA PESERTA PEKERJA BUKAN PENERIMA UPAH BADAN PENYELENGGARA JAMINAN SOSIAL KESEHATAN KANTOR CABANG TASIKMALAYA YANG MENUNGGAK PEMBAYARAN IURAN. Diploma thesis, Universitas Siliwangi.

Raspika, Raspika (2020) PELAKSANAAN STANDAR OPERASIONAL PROSEDUR DALAM PENGELOLAAN DOKUMEN ARSIP PADA PT. BANK NEGARA INDONESIA (PERSERO) Tbk. KANTOR CABANG PEMBANTU CIKURUBUK KOTA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Ratnasari, Rani (2020) ANALISA LAPORAN KEUANGAN DENGAN MENGGUNAKAN METODE TREND COMMON SIZE PERIODE TAHUN 2017-2019 PADA KOPERASI SIMPAN PINJAM SIMPENAN PAMEUNGKEUT BANDA KOTA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Raudya Tahmid, Reka (2020) STRATEGI PEMASARAN PRODUK TAPENAS DALAM MENINGKATKAN JUMLAH NASABAH PADA PT.BANK NEGARA INDONESIA (PERSERO) TBK KCP CIAWI TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Regar, Nur Aysyah (2020) PENGARUH MODAL TETAP, TENAGA KERJA DAN BAHAN BAKU TERHADAP HASIL PRODUKSI TIKAR MENDONG (Studi Kasus pada Industri Tikar Mendong di Kecamatan Purbaratu Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Resa, Resa (2020) MEKANISME PENGAJUAN KARTU KREDIT PADA PT. BANK NEGARA INDONESIA (PERSERO) Tbk. KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Revanita, Yuniar Monica (2020) ANALISIS STRATEGI BAURAN PEMASARAN RITEL AL-MUSLIM MART KAWALU TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Ridwanto, Riki (2019) PENGARUH KUALITAS KEHIDUPAN KERJA DAN KETERLIBATAN KERJA TERHADAP KINERJA KARYAWAN (Penelitian Pada Pegawai Perusahaan Non Manajer Di Kantor Pusat Perusahaan Daerah Air Minum (PDAM) Tirta Sukapura Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Rinaldy, Novia (2022) STUDI EMPIRIS FAKTOR DETERMINASI KEPUTUSAN PEMBELIAN PAKET DATA INTERNET (PADA MAHASISWA JURUSAN EKONOMI PEMBANGUNAN FAKULTAS EKONOMI UNIVERSITAS SILIWANGI). Sarjana thesis, Universitas Siliwangi.

Rizki, Ratih Herawati Al (2022) PENGARUH MINAT DAN KESIAPAN BELAJAR TERHADAP EFEKTIVITAS PEMBELAJARAN DARING (Survey pada peserta didik SMA Negeri 1 Dayeuhluhur tahun ajaran 2021/2022). Sarjana thesis, Universitas Siliwangi.

Rizqiatama, Angga (2021) ANALISIS MANAJEMEN PERSEDIAAN BAHAN BAKU DENGAN METODE ECONOMIC ORDER QUANTITY (EOQ) PADA BIDO COLLECTION. Sarjana thesis, Universitas Siliwangi.

Rohimat, Adi (2020) ANALISIS TATA KELOLA WAKAF TANAH DI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Rohman, Abdul (2019) PERBANDINGAN MEDIA PEMBELAJARAN FLASH CARD DAN FLIP CHART MELALUI MODEL PEMBELAJARAN PICTURE AND PICTURE DALAM MENINGKATKAN HASIL BELAJAR SISWA PADA MATA PELAJARAN EKONOMI. Sarjana thesis, Universitas Siliwangi.

Rohman, Pahrul Pujinur (2019) PENGARUH MODAL DAN TENAGA KERJA TERHADAP PRODUKSI TAHU DI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Roni, Adam (2019) PERAN DPS DALAM PENGAWASAN PEMBIAYAAN MULTIJASA DI BPRS AL-MADINAH TASIKMALAYA. Sarjana thesis, UNIVERSITAS SILIWANGI.

Rosid, Abdul (2020) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI KEPUTUSAN PEMBELIAN PADA KONSUMEN PEDAGANG KAKI LIMA SEKITAR ALUN-ALUN CIAMIS. Sarjana thesis, Universitas Siliwangi.

Royani, Ida (2021) ANALISIS UPAYA PENINGKATAN PENGETAHUAN PRODUK AKAD KEUANGAN SYARIAH PADA PEGAWAI KJKS BMT AL-HIDAYAH CABANG SUTISNA SENJAYA KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Ruhana, Sofa Sri Maryani (2022) IMPLEMENTASI PRINSIP KESEIMBANGAN DAN TANGGUNG JAWAB DALAM PRAKTIK PENGEMBALIAN SISA TRANSAKSI DENGAN BARANG DI PASAR GEGERNOONG KECAMATAN TAMANSARI. Sarjana thesis, Universitas Siliwangi.

Ruhiyat, Ali (2019) ANALISIS FUNGSI PENGORGANISASIAN DALAM PENGHIMPUNAN DANA ZAKAT DI LAZISNU KABUPATEN GARUT. Sarjana thesis, Universitas Siliwangi.

Ruslan, Gusvi Amanda (2020) PENGARUH PERSEPSI MASYARAKAT TERHADAP MINAT MENJADI NASABAH BANK SYARIAH (STUDI EMPIRIS DESA SUKAMULYA KABUPATEN TASIKMALAYA). Sarjana thesis, Universitas Siliwangi.

Rusydiana, Aam Slamet and Firmansyah, Irman and Marlina, Lina (2018) Sentiment Analysis of Microtakaful Industry. INTERNATIONAL JOURNAL OF NUSANTARA ISLAM, 6 (1). pp. 20-34. ISSN 2252-5904

Rusydiana, Aam Slamet and Marlina, Lina (2018) Efficiency, Productivity ans Stability of Islamic Banks in Indonesia. Proceedings 4th SEABC 2018. Sriwijaya Economics, Accounting, and Business Conference Internasional Seminar and Conference, Faculty of Economics, Universitas Sriwijaya Palembang Indonesia. pp. 566-572.

Rusydiana, Aam Slamet and Marlina, Lina (2019) Financial and Social Efficiency on Indonesian Islamic Banks. Journal of Islamic Monetary Economics and Finance, 5 (3). pp. 579-602. ISSN 2460-6146

Rusydiana, Aam Slamet and Marlina, Lina and Rani, Lina Nugraha (2019) Malmquist Productivity Index on Islamic Economics and Finance Research. Journal of Economics and Business Shirkah, 4 (1). pp. 99-131. ISSN 2503-4235

Rusydiana, Aam Slamet and Sudana, Sudana and Marlina, Lina (2019) Manakah Prioritas Sektor Pengembangan Wakaf di Indonesia? JURNAL ECODEMICA, 4 (1). pp. 7-16. ISSN 2355-0295

Rusydiana, Aam Slamet and Tanjung, Hendri and Marlina, Lina (2018) Maslahah Based Measurement on Indonesia Islamic Banks. INTERNATIONAL IURNAL OF ISLAMIC BUSINESS ETHICS, 3 (1). ISSN 978-979-17561-2-9

S

SADAT, AQMAR AMAZIDA (2022) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI BELANJA ONLINE DI MASA PANDEMI PADA MAHASISWA EKONOMI PEMBANGUNAN ANGKATAN 2019 U N I V E R S I T A S S I L I W A N G I. Sarjana thesis, Universitas Siliwangi.

SADEWA, GALIH EKA (2020) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI INVESTASI DI JAWA TENGAH TAHUN 2000-2018. Sarjana thesis, Universitas Siliwangi.

SAEPUL, DEWI MARTIN NUROCHMAH (2022) PENGARUH LIKUIDITAS SAHAM DAN KEBIJAKAN DIVIDEN TERHADAP PENCIPTAAN NILAI (VALUE CREATION) (Survei pada Perusahaan Perbankan yang Terdaftar di Bursa Efek Indonesia Periode 2015 – 2019). Sarjana thesis, Universitas Siliwangi.

SAEPULOH, MUHAMMAD DZIKRI (2022) PROSEDUR PENGAJUAN KREDIT PEMILIKAN RUMAH SUBSIDI PADA PT BANK TABUNGAN NEGARA (Persero) Tbk KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

SAFITRI, DEVI NURLAELA (2022) FAKTOR-FAKTOR YANG MEMPENGARUHI CADANGAN DEVISA INDONESIA PERIODE 2005-2020. Sarjana thesis, Universitas Siliwangi.

SAFITRI, SALMA RAKHMALIA (2022) MEKANISME AKTIVASI DIGI MOBILE BANKING DI PT. BANK PEMBANGUNAN DAERAH JAWA BARAT DAN BANTEN Tbk. KANTOR CABANG TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

SAKINAH, ALYA (2020) PENGARUH PENAGIHAN PAJAK DAN SURAT PAKSA PAJAK TERHADAP PENERIMAAN PAJAK PENGHASILAN PERIODE 2014 - 2018 (Studi Kasus Pada KPP Pratama Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

SALSABILA, FADHILAH (2020) PENGARUH KEPEMILIKAN MANAJERIAL DAN CORPORATE SOCIAL RESPONSIBILITY TERHADAP NILAI PERUSAHAAN (Sensus pada Industri Rokok yang terdaftar di Bursa Efek Indonesia Tahun 2012-2018). Sarjana thesis, Universitas Siliwangi.

SALSABILA, SAHRA (2020) PENGARUH UKURAN DEWAN KOMISARIS, UKURAN PERUSAHAAN, KEPEMILIKAN SAHAM PUBLIK DAN KEPEMILIKAN MANAJERIAL TERHADAP IMPLEMENTASI CORPORATE SOCIAL RESPONSIBILITY (Survei pada Perusahaan Basic Industry and Chemicals yang Terdaftar Di Bursa Efek Indonesia Tahun 2017-2018). Sarjana thesis, Universitas Siliwangi.

SALWATI, ASA MANNA (2021) ANALISIS EKONOMI SEKTOR BASIS DI KABUPATEN PENAJAM PASER UTARA TAHUN 2015-2019. Sarjana thesis, Universitas Siliwangi.

SANDRAINI, VERRA (2021) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI PRESTASI BELAJAR EKONOMI PESERTA DIDIK (Survey Pada Peserta Didik Kelas X IPS SMA Negeri 6 Kota Tasikmalaya Tahun Ajaran 2020/2021). Sarjana thesis, Universitas Siliwangi.

SAPARI, RIZA PAISAL (2019) PENGARUH PENGENDALIAN PERSEDIAAN BAHAN BAKU, PEMELIHARAAN MESIN DAN PENGENDALIAN KUALITAS TERHADAP PRODUKTIVITAS PERUSAHAAN (Penelitian Pada Perusahaan Hasgradini Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

SAPUTRA, GUNAWAN (2021) ANALISIS PENILAIAN PELANGGAN PADA DIMENSI KUALITAS PELAYANAN TOKO BUKU LATUNSA RIYADLUL ULUM WADDA’WAH DI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

SAPUTRA, MUHAMAD WISNU (2020) ANALISIS PERTUMBUHAN EKONOMI DI INDONESIA TAHUN 2007-2018. Sarjana thesis, Universitas Siliwangi.

SAPUTRI, GINNI JULIANTI DWI (2021) ANALISIS PENGARUH INFLASI, BI RATE DAN LAJU PERTUMBUHAN EKONOMI TERHADAP RETURN ON ASSET PADA BANK BUMN DI INDONESIA TAHUN 2013-2020. Sarjana thesis, Universitas Siliwangi.

SARI, IRMA IMAN (2020) PENGARUH ZAKAT DAN CORPORATE SOCIAL RESPONSIBILITY TERHADAP KINERJA KEUANGAN BANK UMUM SYARIAH DI INDONESIA (Survey Pada Bank Umum Syariah yang Terdaftar di Otoritas Jasa Keuangan Periode 2010-2018). Sarjana thesis, Universitas Siliwangi.

SARI, MERI WULAN (2021) ANALISIS SEKTOR UNGGULAN DAN KETIMPANGAN PENDAPATAN DI WILAYAH III CIREBON TAHUN 2015-2019. Sarjana thesis, Universitas Siliwangi.

SARIYANI, MARISA INTI (2021) PENGARUH RETURN ON ASSETS, NET PROFIT MARGIN, DAN PRICE EARNING RATIO TERHADAP HARGA SAHAM (PADA PT. AKR CORPORINDO Tbk.). Sarjana thesis, Universitas Siliwangi.

SATILA, SUNIYA (2019) ANALISIS PENERIMAAN PEDAGANG KAKI LIMA CAR FREE DAY DI KABUPATEN GARUT. Sarjana thesis, Universitas Siliwangi.

SATRIA, BAGUS (2021) PENGARUH VIRAL MARKETING DALAM MEMBANGUN BRAND TRUST MELALUI BRAND AWARENESS (Kasus pada pengguna e-commerce marketplace di Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

SELA SINTIA, TIA (2019) PENGARUH KEPEMIMPINAN KEPALA SEKOLAH TERHADAP KINERJA GURU SMA NEGERI SE-KOTA TASIKMALAYA (Survey Terhadap Guru Ekonomi SMA Negeri Se-kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

SENJAYA, DICKI (2019) PENGARUH IMPOR, PRODUKSI DAN KONSUMSI BERAS TEEHADAP HARGA BERAS DI INDONESIA PERIODE 2009-2018. Sarjana thesis, Universitas Siliwangi.

SEPTI ANGGIA, ANISA (2019) PERANANAN KEMAMPUAN PAJAK DAERAH RETRIBUSI DAERAH DAN LABA BUMD DALAM MENINGKATKAN PENDAPATAN ASLI DAERAH DI PROVINSI JAWA BARAT TAHUN 2004-2017. Sarjana thesis, Universitas Siliwangi.

SEPTIAN, YUDI (2021) ANALISIS PREFERENSI MAHASISWA UNIVERSITAS SILIWANGI TERHADAP BANK SYARIAH. Sarjana thesis, Universitas Siliwangi.

SEPTIAN MAULANA, AGUS (2020) ANALISIS BEBAN KERJA KARYAWAN BAGIAN PEMASARAN DI BPRS AL-MADINAH KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

SEPTIANA, GILANG (2020) ANALISIS STRATEGI BAURAN PEMASARAN PADA KELOM GEULIS SHENY. Sarjana thesis, Universitas Siliwangi.

SEPTIANA, LINDA (2020) PENGARUH FIRM SIZE, LEVERAGE, DAN SIZE OF THE SHARIA SUPERVISORY BOARD TERHADAP PROFITABILITAS (Survey pada Unit Usaha Syariah Periode 2015-2019). Sarjana thesis, Universitas Siliwangi.

SEPTIAWAN, DERRY (2019) FAKTOR – FAKTOR YANG MEMPENGARUHI INFLASI DI INDONESIA TAHUN 2008 -2017. Sarjana thesis, Universitas Siliwangi.

SEPTYANTARI, ANDINI (2022) KETIMPANGAN PEMBANGUNAN: STUDI KASUS PADA KABUPATEN/KOTA DI PROVINSI BANTEN TAHUN 2016-2020. Sarjana thesis, Universitas Siliwangi.

SETAWATI, HANI (2020) PENGARUH PENEMPATAN TENAGA KERJA, PENGEMBANGAN KARIR DAN KEMAMPUAN KERJA TERHADAP PRESTASI KERJA (Suatu Penelitian Pada Karyawan Non Manajer PT.Gramedia Asri Media Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

SETIAWAN, AZIS AZHAR (2019) PENGARUH LABEL HALAL DAN CITA RASA PADA MAKANAN SIAP SAJI TERHADAP KEPUTUSAN PEMBELIAN MAHASISWA FAKULTAS AGAMA ISLAM UNIVERSITAS SILIWANGI. Sarjana thesis, Universitas Siliwangi.

SETIAWAN, HENDRIK (2020) ANALISIS PENGHIMPUNAN DANA ZIS MELALUI PROGRAM KOIN NU DALAM MENUMBUHKAN NILAI FILANTROPI DI LAZISNU KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

SETIAWAN, INTEN VERONICA MARIAM (2019) PENGARUH CAPITAL ADEQUACY RATIO (CAR) DAN NON PERFORMING LOAN (NPL) TERHADAP RETURN ON ASSET (ROA) PADA PT. BANK MANDIRI (Persero) Tbk. Sarjana thesis, Universitas Siliwangi.

SETIAWAN, NENDEN YULIYANTI (2021) PENGUJIAN EFISIENSI PASAR BERDASARKAN ABNORMAL RETURN DARI STOCK SPLIT. Sarjana thesis, Universitas Siliwangi.

SETIAWATI, NITA (2020) ANALISIS PEMBIAYAAN MURABAHAH PADA PERBANKAN SYARIAH DI INDONESIA PERIODE 2014 – 2018. Sarjana thesis, Universitas Siliwangi.

SHAUMI, ADRY MUHAMMAD (2020) STRATEGI PEMASARAN DALAM PENERIMAAN JUMLAH NASABAH TABUNGAN DI PD. BPR ARTHA SUKAPURA KANTOR PUSAT TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

SHIDDIQY, MUHAMAD ZULFIKAR ASH (2019) PENGARUH PENGENDALIAN PERSEDIAAN BAHAN BAKU DAN PENGENDALIAN KUALITAS TERHADAP PRODUKTIVITAS PRODUK PT. BINEATAMA KAYONE LESTARI DI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

SIDIQ, DZIKRI MUHAMMAD DZULFIQAR (2020) PENGARUH STANDAR OPERASIONAL PROSEDUR DAN LINGKUNGAN KERJA TERHADAP PRODUKTIVITAS KARYAWAN (Studi Pada Karyawan PT.Bineatama Kayone Lestari Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

SIDIQ, USEP MUHAMMAD PAJRI (2020) PENGARUH HARGA KAKAO INTERNASIONAL, NILAI TUKAR DAN TINGKAT INFLASI TERHADAP VOLUME EKSPOR KAKAO INDONESIA PADA TAHUN 2004-2018. Sarjana thesis, Universitas Siliwangi.

SILA, RESA NUR (2020) MEKANISME PELAPORAN SPT 1770 (USAHAWAN ATAU PEKERJA BEBAS) SECARA ELEKTRONIK PADA KANTOR PELAYANAN PAJAK PRATAMA CIAMIS. Diploma thesis, Universitas Siliwangi.

SIMANJUNTAK, ATIKA (2021) ANALISIS PERTUMBUHAN EKONOMI DI INDONESIA MELALUI PENDEKATAN MIDDLE-INCOME TRAP TAHUN 1990-2019. Sarjana thesis, Universitas Siliwangi.

SINTIA, AYU SINTA (2021) ANALISIS HARGA, KUALITAS PRODUK, KUALITAS INFORMASI, CITRA MEREK DAN DISTRIBUSI SEBAGAI FAKTOR PENENTU KEPUTUSAN PEMBELIAN HIJAB SECARA ONLINE (Survei pada Mahasiswa Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

SIROJUDIN, AGUS (2020) PENGARUH LAYANAN MEMBER CARD DAN INOVASI MARKETING TERHADAP LOYALITAS PELANGGAN DI AL MUSLIM MART. Sarjana thesis, Universitas Siliwangi.

SITI ALIA, DESTRI (2019) ANALISIS KEMISKINAN DITINJAU DARI SUDUT PRODUKTIVITAS TENAGA KERJA SEKTOR EKONOMI PROVINSI JAWA BARAT TAHUN 2003-2017. Sarjana thesis, Universitas Siliwangi.

SOLEHUDIN, SOLEHUDIN (2022) PENGARUH PROFITABILITAS, LEVERAGE, DAN UKURAN PERUSAHAAN TERHADAP MANAJEMEN LABA (Survei Pada Perusahaan Manufaktur Sub Sektor Makanan dan Minuman Yang Terdaftar di Bursa Efek Indonesia Periode 2016–2020). Sarjana thesis, Universitas Siliwangi.

SOLIHAH, IRMA (2020) PENGARUH DEPOSITO MUDHARABAH DAN NON PERFORMING FINANCING (NPF) TERHADAP PEMBIAYAAN BAGI HASIL (Studi Kasus Pada Bank Rakyat Indonesia Syariah Tahun 2013-2019). Sarjana thesis, Universitas Siliwangi.

SOLIHATUN NISA, ANIS (2019) PENERAPAN MODEL PEMBELAJARAN PROBING PROMPTING DALAM UPAYA MENINGKATKAN HASIL BELAJAR (Studi Quasi Eksperimen Pada Mata Pelajaran Ekonomi Peserta Didik Kelas XI di SMA Negeri 3 Tasikmalaya Semester Genap Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

SONATA, DIAN PUSPACITRA (2021) PENGARUH EFIKASI DIRI, DUKUNGAN KELUARGA, DAN ORIENTASI MASA DEPAN TERHADAP PENGAMBILAN KEPUTUSAN KARIER MENJADI GURU (Survei pada Mahasiswa Pendidikan Ekonomi Angkatan 2016 Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

SUDRAJAT, DINDA TRI AGUSTIN (2021) PENGARUH FASILITAS BELAJAR DAN KREATIVITAS GURU TERHADAP PRESTASI BELAJAR (Survey pada Peserta Didik Kelas XI IPS dan MIPA Pada Mata Pelajaran Ekonomi SMA Negeri 7 Kota Tasikmalaya Tahun Ajaran 2019/2020). Sarjana thesis, Universitas Siliwangi.

SUGANDA, GINANJAR MUHAMMAD (2021) PENGARUH PENANAMAN MODAL ASING, PENANAMAN MODAL DALAM NEGERI, TENAGA KERJA, DAN INFRASTRUKTUR JALAN TERHADAP PERTUMBUHAN EKONOMI DI PROVINSI JAWA BARAT TAHUN 2000-2019. Sarjana thesis, Universitas Siliwangi.

SUHERLAN, ANTON (2022) PENGARUH LITERASI KEUANGAN, DAN LOCUS OF CONTROL TERHADAP KINERJA KEUANGAN UMKM (Pada Pelaku usaha UMKM di Jalan Perintis Kemerdekaan dan Jalan Tentara Pelajar Kota Banjar Patroman). Sarjana thesis, Universitas Siliwangi.

SUPRIATNA, MUHAMMAD ILHAM FAUZAN (2022) ANALISIS PENGENDALIAN KUALITAS PRODUK DENGAN METODE STATISTICAL QUALITY CONTROL (SQC) PADA PERUSAHAAN ROTI MASTER BAKERY DI TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

SURBAKTI, GELORA KASIH (2022) PENGARUH DISIPLIN KERJA DAN LINGKUNGAN KERJA TERHADAP KINERJA KARYAWAN TETAP ADMINISTRASI PT. MUARA SENTRAL UTAMA KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

SURYANA, MOCHAMAD ILHAM FAUZI (2020) ANALISIS PROMOSI PADA PENJUALAN PRODUK DI POSSIBLE DEPARTEMENT (CLOTHINGSTORE) TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

SURYANAH, IKE (2020) ANALISIS FAKTOR-FAKTOR TURNOVER INTENTION KARYAWAN WEDDING ORGANIZER PADA PERUSAHAAN PRO.ART PRODUCTION DI TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

SUSANTI, NENG YESI (2021) ANALISIS KOMPARATIF DAMPAK PANDEMI COVID-19 TERHADAP TRANSAKSI DIGITAL, STABILITAS SISTEM KEUANGAN, INKLUSI KEUANGAN DAN RASIO KESEHATAN BANK DI INDONESIA. Sarjana thesis, Universitas Siliwangi.

SUSANTO, MOHAMMAD RYAN FIRDAUS (2021) PENGARUH PEMBIAYAAN MUDHARABAH DAN PEMBIAYAAN MUSYARAKAH TERHADAP PROFITABILITAS (Survey Pada Bank Syariah di Indonesia Periode 2015-2019). Sarjana thesis, Universitas Siliwangi.

SUTANTO, JANUAR (2019) ANALISIS FAKTOR-FAKTOR INTERNAL YANG MEMPENGARUHI KEPUTUSAN PEMILIHAN LINTAS MINAT MATA PELAJARAN EKONOMI DI SMAN 8 TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

SUYUDI, NANDI (2018) PENGARUH MINAT BELAJAR TERHADAP HASIL BELAJAR SISWA (Studi Survei Terhadap Siswa Kelas XI IPS Pada Mata Pelajaran Ekonomi di SMA Negeri 4 Pangandaran Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

SWARDHIKA, NUGRAHA ADHI (2021) ANALISIS SEKTOR PARIWISATA TERHADAP PENDAPATAN ASLI DAERAH (PAD) TAHUN 2010-2019 DI PROVINSI JAWA BARAT. Sarjana thesis, Universitas Siliwangi.

SYAFRULLAH, FAHRI (2020) ANALISIS CADANGAN DEVISA : STUDI EMPIRIS PADA PEREKONOMIAN INDONESIA TAHUN 2009-2018. Sarjana thesis, Universitas Siliwangi.

SYAHRIN, ALFI (2020) ANALISIS POTENSI PENDAPATAN ASLI DAERAH SEKTOR PARIWISATA DI KABUPATEN KUNINGAN. Sarjana thesis, Universitas Siliwangi.

SYAHRUL RAMADHAN, ESA (2019) PENGARUH FASILITAS BELAJAR DAN MINAT BELAJAR TERHADAP HASIL BELAJAR SISWA (Survey Terhadap Mata Pelajaran Prakarya dan Kewirausahaan Kelas XII SMK Negeri 2 Tasikmalaya Semester Genap Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

SYAMSI YAH, YANI FARAMDI (2020) EFEKTIVITAS PENGENDALIAN KREDIT MACET PADA PT BANK PERKREDITAN RAKYAT SILIWANGI TASIKMALAYA KANTOR PUSAT OPERASIONAL KOTA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

SYARIFAH, NUR GHINA (2020) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI PROKRASTINASI AKADEMIK DALAM PENYELESAIAN TUGAS MATA PELAJARAN EKONOMI (Survey Pada Siswa Kelas XI dan XII SMA Negeri 8 Tasikmalaya Tahun Ajaran 2020/2021). Sarjana thesis, Universitas Siliwangi.

Saeful, Muhammad Rizal (2008) PENGARUH KUALITAS PRODUK DAN KUALITAS PELAYANAN TERHADAP KEPUASAN PELANGGAN ONLINE DI PERUSAHAAN MUKENA YUMNA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Saepul Mukmin, Hadiat (2021) ANALISIS PELAKSANAAN AKAD MURABAHAH PADA PEMBIAYAAN MODAL USAHA DI KSPSS BMT AL-BINA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Salzadilla, Sheila (2021) ANALISA PERBANDINGAN LAPORAN KEUANGAN PADA KOPERASI SIMPAN PINJAM SIMPANAN PAMEUNGKEUT BANDA (KSP SPB) PERIODE TAHUN 2019-2020 KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Santosa, Rizal Fajar (2020) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI VOLUME PENJUALAN TAHU BULAT WINDO JAYA DI TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Sapaat, Tatang (2018) ANALISIS PEMBERDAYAAN EKONOMI MUSTAHIK DALAM PENDAYAGUNAAN ZAKAT PRODUKTIFDI BADAN AMILZAKAT NASIONAL KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Saptayati, Nur Endah Mart (2022) PERANAN SISTEM LAYANAN INFORMASI KEUANGAN (SLIK) TERHADAP PEMBERIAN KREDIT GUNA BHAKTI PADA PT. BANK PEMBANGUNAN DAERAH JAWA BARAT DAN BANTEN, Tbk KANTOR CABANG SINGAPARNA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Sarah Ramadhina, Siti (2019) PENGARUH ETOS KERJA ISLAM DAN SISTEM UJRAH TERHADAP PRODUKTIVITAS KERJA PENGRAJIN TIKAR MENDONG DI MAKMUR ABADI KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Sari, Nira (2021) ANALISIS EFEKTIVITAS PENDAYAGUNAAN DANA INFAK DAN SEDEKAH UNTUK PROGRAM PEMBINAAN KARAKTER PENERIMA BEASISWA TELADAN NEGERI (Studi Pada Lembaga Amil Zakat Rumah Amal Salman). Sarjana thesis, Universitas Siliwangi.

Saripah, Ipe (2021) PROSEDUR KLAIM SANTUNAN DENGAN SISTEM OVER BOOKING TERHADAP KORBAN KECELAKAAN PADA PT. JASA RAHARJA KANTOR PERWAKILAN TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Saripudin, Agus (2020) ANALISIS STRATEGI PENDAYAGUNAAN DANA ZIS PADA LEMBAGA AMIL ZAKAT INFAK SEDEKAH MUHAMMADIYAH (LAZISMU) KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Septian, Luchy Luchyana (2020) PENERAPAN PRINSIP KYC (KNOW YOUR CUSTOMER) UNTUK ANTI MONEY LAUNDERING (AML) DAN PENDANAAN TERORISME PADA PT. BANK NEGARA INDONESIA (PERSERO) Tbk. KANTOR CABANG PEMBANTU CIAMIS. Diploma thesis, Universitas Siliwangi.

Septiandi, Dede Aji (2021) ANALISIS IMPLEMENTASI PRINSIP PEMASARAN SYARIAH BERBASIS MEDIA SOSIAL DI LEARNING CENTRE MIRELLYS HOUSE KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Septiansah, Ilham (2020) ANALISIS STRATEGI PEMASARAN DI SHOWROOM ERSA MOTOR SINGAPARNA. Sarjana thesis, Universitas Siliwangi.

Setiadi, Maulin Juniar (2022) PENGARUH RAGAM MOTIF, MODAL USAHA, DAN TENAGA KERJA TERHADAP PENDAPATAN PENGUSAHA KERAJINAN ANYAMAN TAS DI DESA RAJAPOLAH. Sarjana thesis, Universitas Siliwangi.

Sidiq, Andi Yuga Pratama (2019) ANALISIS STRATEGI PEMASARAN SYARIAH DI PERUSAHAAN HIJAB VERSANITY KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Sifa, Aulia (2020) ANALISIS MANAJEMEN PRODUKSI PADA PERUSAHAAN KONVEKSI ASGAL (ASLI GALUNGGUNG) SPORT KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Silviani, Elsa (2019) PENERAPAN MODEL PEMBELAJARAN COOPERATIVE TIPE GROUP INVESTIGATION (GI) TERHADAP PEMAHAMAN KONSEP BELAJAR SISWA (Studi Quasi Eksperimen Pada Mata Pelajaran Ekonomi Kelas X IPS SMA Negeri Taraju Kabupaten Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Soleha, Lilis (2022) PEMBERDAYAAN EKONOMI MASYARAKAT PADA PROGRAM GERAKAN SATU JUTA MUNFIQ DI BAZNAS KABUPATEN TASIKMALAYA (Studi Kasus di Kampung Cicarulang Desa Cikunten Kecamatan Singaparna). Sarjana thesis, Universitas Siliwangi.

Sonjaya, Oki (2020) PROSEDUR PELAKSANAAN PEMBIAYAAN AKAD MURABAHAH PADA BNI GRIYA iB HASANAH DI PT. BANK BNI SYARIAH KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Sopandi, Opan (2019) PENERAPAN PENDEKATAN CONTEXTUAL TEACHING AND LEARNING MENGGUNAKAN MODEL PEMBELAJARAN EXAMPLE NON-EXAMPLES DALAM MENINGKATKAN KEMAMPUAN BERPIKIR ANALISIS PESERTA DIDIK (Studi Kuasi Eksperimen Pada Peserta Didik Kelas XI Jurusan Bisnis Daring dan Pemasaran (BDP) Mata Pelajaran Ekonomi Bisnis di SMK Negeri Rajapolah Kabupaten Tasikmalaya Semester Ganjil Tahun Pelajaran 2019/2020). Sarjana thesis, Universitas Siliwangi.

Sri Rahayu, Yuliana (2020) PROSEDUR PENGAJUAN KREDIT PEMILIKAN RUMAH (KPR) BTN SUBSIDI BAGI MASYARAKAT BERPENGHASILAN RENDAH (MPR) DI PT. BANK TABUNGAN NEGARA (Persero) Tbk. KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Srigantini, Vivit (2020) EFISIENSI PENGELOLAAN DANA ZAKAT, INFAK DAN SEDEKAH PADA ORGANISASI PENGELOLA ZAKAT DI INDONESIA (Studi Kasus Pada BAZNAS dan Rumah Zakat Periode 2010-2017). Sarjana thesis, Universitas Siliwangi.

Subhiyati, Siti (2020) ANALISIS PENERAPAN PROSEDUR PEMBIAYAAN MURABAHAH KONSUMTIF PADA PEMBIAYAAN KESEJAHTERAAN PEGAWAI (PKP) DI BJB SYARIAH KCP BANJAR. Sarjana thesis, Universitas Siliwangi.

Subhiyati, Siti (2020) ANALISIS PENERAPAN PROSEDUR PEMBIAYAAN MURABAHAH KONSUMTIF PADA PEMBIAYAAN KESEJAHTERAAN PEGAWAI (PKP) DI BJB SYARIAH KCP BANJAR. Sarjana thesis, Universitas Siliwangi.

Sudiana, Sudiana and Marlina, Lina (2019) Pengaruh Kecukupan Modal dan Efisiensi Operasional terhadap Profitabilitas pada Bank CIMB Niaga Syariah. SYNTAX LITERATE : JURNAL ILMIAH INDONESIA, 4 (1). pp. 150-170. ISSN 2541-0849

Sudjoko, - and Kusmayadi, Dedi and Badruzaman, Jajang (2017) KOMPUTER AKUNTANSI SIAP PAKAI PERUSAHAAN INDUSTRI MANUFAKTUR. Hasil Reviewer. pp. 1-92. ISSN 978-979-1448-08-6

Sukarso, Aso and Hastuti Lestari Komarlina, Dwi and Budiman, Rahman (2013) Analisis Faktor Penentu Pertumbuhan Ekonomi dan Kebutuhan Investasi di Jawa Barat Tahun 2002-2011. JURNAL ILMU EKONOMI, 3 (2). pp. 588-599. ISSN 2301-8828

Sulviah Ningsih, Evi and Sukono, - and Rusyaman, Endang and Badruzaman,, Jajang (2019) Kelly's Strategy Analysis in Optimizing Investment Portfolios in Foreign Exchange. Hasil Uji Kemiripan, 8 (2S7). pp. 245-250. ISSN 277-3878

Sundawa, Ilmi Lasni (2020) IMPLEMENTASI PROGRAM MISYKAT DT PEDULI PRIANGAN TIMUR DI MAJELIS MISYKAT AL-HIDAYAH, DESA MEKARJAYA, KECAMATAN PADAKEMBANG, KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Supenti, Penti (2019) ANALISIS EFISIENSI BANK UMUM SYARIAH DI INDONESIA MENGGUNAKAN METODE DATA ENVELOPMENT ANALYSIS (DEA) Periode 2015-2017. Sarjana thesis, Universitas Siliwangi.

Surahman, Endang and Kamil, Popo Musthofa and Marlina, Lina (2016) Pengembangan Model Pembelajaran Ilmu Kealaman Dasar (IKD) Berbasis Integrasi Islam-Sains Untuk Membangun Karakter Mahasiswa Universitas Siliwangi. JURNAL SILIWANGI (Seri Pendidikan), 2 (2). pp. 92-97. ISSN 2476-9312

Surya Pratama, Chiko (2019) PENGARUH KEPEMIMPINAN DAN INSENTIF TERHADAP KINERJA KARYAWAN DI WARUNG SANGU NINI ANTEH KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Suryana, Mochamad Ilham Fauzi (2020) ANALISIS PROMOSI PADA PENJUALAN PRODUK DI POSSIBLE DEPARTEMENT (CLOTHINGSTORE) TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Suryanto, Asep and Marlina, Lina and Rahmat, Biki Zulfikri (2020) Islamic Philanthropy: Waqf Empowerment of Madina Minimarket in Tasikmalaya Indonesia. Jurnal Ekonomi dan Bisnis Islam, IKONOMIKA, 2 (1). pp. 1-16. ISSN 2527-5143

Sutiawan, Acep (2019) ANALISIS STRATEGI PEMASARAN PADA PRODUK KEJU MOZARELLA KPBS PANGALENGAN. Sarjana thesis, Universitas Siliwangi.

Sutrisno, Widiastuti (2020) ANALISIS PENGANGGURAN KOTA BANJAR. Sarjana thesis, Universitas Siliwangi.

Sutriyana, Yana (2021) ANALISIS STRATEGI PEMASARAN PADA PRODUK GIRO iB MASLAHAH PERORANGAN DI BJB SYARIAH KCP CIAMIS. Sarjana thesis, Universitas Siliwangi.

Syafira, Raden Najla (2021) ANALISIS PENERAPAN PRINSIP KEJUJURAN (FAIRNESS) PADA PERILAKU PEDAGANG KAKI LIMA DI MASJID AGUNG TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Syaifulmilah, Fajri Yusup (2019) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI PERMINTAAN IMPOR DAGING SAPI DI INDONESIA TAHUN 2008-2019. Sarjana thesis, Universitas Siliwangi.

Syakinah, Kiki Armadiatus (2022) PENGARUH NPF DAN FDR TERHADAP ROA BANK PEMBIAYAAN RAKYAT SYARIAH DI JAWA BARAT (Periode Pertama Pandemi Covid-19 Tahun 2020). Sarjana thesis, Universitas Siliwangi.

Syamsiyah, YanifaRamdiatus (2020) EFEKTIVITASPENGENDALIANKREDITMACETPADAPTBANK PERKREDITANRAKYATSILIWANGITASIKMALAYAKANTORPUSAT OPERASIONALKOTATASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Syllabi, Liston Arbi (2022) PENGARUH PEMBIAYAAN PERBANKAN DAN MODAL KERJA TERHADAP PENDAPATAN USAHA MIKRO DAN KECIL DI PASAR PANCASILA KOTA TASIKMALAYA (Survei pada Pelaku UMK di Pasar Pancasila Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

T

TAHIRA, ANINDIA TASYA (2022) ANALISIS PENGARUH KETIMPANGAN GENDER TERHADAP PRODUK DOMESTIK REGIONAL BRUTO 6 PROVINSI DI PULAU JAWA TAHUN 2014-2019. Sarjana thesis, Universitas Siliwangi.

TANJUNG, RAHMATUN BERLIAN (2021) ANALISIS DETERMINASI EKSPOR TEMBAKAU INDONESIA KE NEGARA TUJUAN UTAMA TAHUN 2002-2019. Sarjana thesis, Universitas Siliwangi.

TANJUNGSARI, WITRI (2020) ANALISIS PENGARUH DANA DESA TERHADAP KEMISKINAN (Studi Kasus pada 16 Desa di Kota Banjar Periode 2015 - 2018). Sarjana thesis, Universitas Siliwangi.

TAOPIK, EVAN (2020) ANALISIS PENENTU VOLUME EKSPOR CRUDE PALM OIL INDONESIA SERTA PENGARUHNYA TERHADAP PAJAK EKSPOR (STUDI KASUS EKSPOR KE TIONGKOK PERIODE TAHUN 2007-2018). Sarjana thesis, Universitas Siliwangi.

TAUFIK, RIFAT (2016) PENGARUH KEPEMIMPINAN KEPALA SEKOLAH TERHADAP EFEKTIFITAS KERJA GURU SMK NURUSALAM SALOPA KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

THARIY, HASNAA (2021) PENDAPATAN DAN KONSUMSI RUMAH TANGGA MISKIN DI DESA SINDANGHERANG KECAMATAN PANUMBANGAN KABUPATEN CIAMIS (Studi Komparasi Sebelum dan Pada Masa Pandemi Covid-19). Sarjana thesis, Universitas Siliwangi.

TRIMULYA, MESA (2019) PENGARUH KOMPETISI DALAM KEGIATAN BELAJAR TERHADAP MOTIVASI BERPRESTASI SISWA (Survey Pada Siswa SMA Kelas XII IPS di SMAN 1 Manonjaya Pada Mata Pelajaran Ekonomi). Sarjana thesis, Universitas Siliwangi.

TRISKY DESMIRAWA, YOSI (2022) PENGARUH CURRENT RATIO, DAN DEBT TO EQUITY RATIO TERHADAP RETURN ON ASSET (Kasus Pada PT Ace Hardware Indonesia Tbk). Sarjana thesis, Universitas Siliwangi.

TRISNADI, MUHAMMAD YUSUP GINANJAR (2022) PENGARUH GAJI, LINGKUNGAN KERJA DAN BUDAYA KERJA TERHADAP KEPUASAN KERJA (Kasus Pada Karyawan Pramuniaga Dan Kasir di Toserba Gunasalma). Sarjana thesis, Universitas Siliwangi.

TRIZALDI WIDYANA, ALDI (2019) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI TABUNGAN NASIONAL DI INDONESIA PERIODE 2002-2016. Sarjana thesis, Universitas Siliwangi.

TULOH, PUJIAR RAHMAT (2020) PERBANDINGAN LIKUIDITAS SAHAM DAN RETURN SAHAM SEBELUM DAN SESUDAH STOCK SPLIT (Pada Perusahaan Jasa Di Bursa Efek Indonesia). Sarjana thesis, Universitas Siliwangi.

Taufinda, Karina (2020) PENGARUH PELATIHAN DAN MOTIVASI TERHADAP KINERJA KARYAWAN DI CV. SKYLAR CORPORATION TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Teguh Rizal, Mohamad (2018) ANALISIS PERSEPSI PELAKU UMKM TENTANG BANK SYARIAH (Studi Penelitian pada UMKM Makanan Ringan di Kecamatan Cikoneng Kabupaten Ciamis). Sarjana thesis, Universitas Siliwangi.

Tohari, Heri (2020) ANALISIS PEMBERDAYAAN EKONOMI MASYARAKAT MISKIN MELALUI AKSES PEMBIAYAAN DI LEMBAGA KEUANGAN MIKRO SYARIAH (LKMS) BANK WAKAF MIKRO RANAH INDAH DARUSSALAM CIAMIS. Sarjana thesis, Universitas Siliwangi.

Tresna, Ayu Sucita (2019) PENGARUH INDEKS NIKKEI 225, BI RATE, KURS DAN LAJU PERTUMBUHAN EKONOMI TERHADAP INDEKS HARGA SAHAM GABUNGAN (IHSG) PERIODE 2003-2017. Sarjana thesis, Universitas Siliwangi.

Tri Yunita, Anindya (2019) PENGARUH LINGKUNGAN SEKOLAH TERHADAP MOTIVASI BELAJAR DAN IMPLIKASINYA TERHADAP PRESTASI BELAJAR SISWA. Sarjana thesis, Universitas Siliwangi.

Trisnawati, Nurul (2020) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI PENYERAPAN TENAGA KERJA DI PROVINSI BANTEN TAHUN 2014-2018. Sarjana thesis, Universitas Siliwangi.

U

UTAMA, ANGGA AZIZ SAPUTRA (2021) PROSEDUR PEMBERIAN KREDIT KPR BERSUBSIDI DI BANK TABUNGAN NEGARA (PERSERO) TBK KANTOR CABANG CIKARANG. Diploma thesis, Universitas Siliwangi.

UTAMI, ANNISA DWI (2021) STRATEGI PEMASARAN DALAM PRODUK TABUNGAN TAPLUS MUDA PADA PT. BANK NEGARA INDONESIA (PERSERO) Tbk. KANTOR CABANG PEMBANTU PANGANDARAN. Diploma thesis, Universitas Siliwangi.

Ulfah Fauziyah, Elsa (2019) ANALISIS IMPLEMENTASI DISTRIBUSI HASIL DANA ZAKAT PRODUKTIF PADA MINIMARKET MADINA DI TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Utama, Rizki Akbari (2021) PENGARUH IMPLEMENTASI NILAI-NILAI ETIKA ISLAM DALAM PELAYANAN TERHADAP KEPUASAN PENGUNJUNG HOTEL SRIKANDI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Utomo, Muhammad Yusuf (2020) PENGARUH PROMOSI PENJUALAN DAN PHYSICAL EVIDENCE TERHADAP TINGKAT PERMINTAAN PESANAN JASA LAYANAN TRANSPORTASI ONLINE (studi kasus pada pelanggan gojek di Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

V

Vikria Namania, Gina (2019) PERBANDINGAN MODEL PEMBELAJARAN INKUIRI TERBIMBING DAN GROUP INVESTIGATION DALAM MENINGKATKAN KEMAMPUAN BERPIKIR KREATIF PESERTA DIDIK PADA MATA PELAJARAN EKONOMI (Studi Quasi Eksperimen pada Mata Pelajaran Ekonomi Kelas X IPS SMA Negeri 2 Singaparna Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

W

WAHYUNI, RACHMI SRI (2020) PENGARUH INDEKS PEMBANGUNAN MANUSIA, RASIO BEBAN KETERGANTUNGAN DAN TINGKAT PARTISIPASI ANGKATAN KERJA TERHADAP LAJU PERTUMBUHAN EKONOMI JAWA BARAT TAHUN 2004-2019. Sarjana thesis, Universitas Siliwangi.

WAHYUNI, RACHMI SRI (2020) PENGARUH INDEKS PEMBANGUNAN MANUSIA, RASIO BEBAN KETERGANTUNGAN DAN TINGKAT PARTISIPASI ANGKATAN KERJA TERHADAP LAJU PERTUMBUHAN EKONOMI JAWA BARAT TAHUN 2004-2019. Sarjana thesis, Universitas Siliwangi.

WALIY, NURMAN MOHAMAD ADAM ABDUL (2022) PENGARUH BEBAN KERJA DAN STRES KERJA TERHADAP PRODUKTIVITAS KERJA KARYAWAN OPERASIONAL PABRIK DI CV. AL-ZIDAN GARMEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

WANDINI, WIDA (2018) FAKTOR-FAKTOR YANG MEMPENGARUHI PENYERAPAN TENAGA KERJA PADA SEKTOR INDUSTRI TEKSTIL TAHUN 2006-2015 (Studi Kasus Provinsi Jawa Barat dan Provinsi Jawa Tengah). Sarjana thesis, Universitas Siliwangi.

WIDIYANTI, SUSI EKA (2021) ANALISIS KINERJA KEUANGAN DAERAH SERTA PENGARUHNYA TERHADAP PERTUMBUHAN EKONOMI PROVINSI JAWA BARAT TAHUN 2010-2019. Sarjana thesis, Universitas Siliwangi.

WIDYAN DWIPUTRA, ALDI (2019) PENGARUH DESAIN PRODUK DAN PENGENDALIAN KUALITAS TERHADAP KUALITAS PRODUK (Survey Pada Pegawai Almer Kebaya Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

WULAN, DEVI RATNA (2021) PENGARUH KREATIVITAS MENGAJAR GURU EKONOMI, IKLIM SEKOLAH DAN DISIPLIN PESERTA DIDIK TERHADAP PRESTASI BELAJAR PESERTA DIDIK KELAS X IPS DI SMA NEGERI 10 TASIKMALAYA TAHUN PELAJARAN 2019/2020. Sarjana thesis, Universitas Siliwangi.

Wibisana, Gunara (2021) PENGARUH INDEKS HANG SENG, INFLASI, SUKU BUNGA, DAN NILAI TUKAR TERHADAP INDEKS HARGA SAHAM GABUNGAN (IHSG) DI INDONESIA TAHUN 2005-2019. Sarjana thesis, Universitas Siliwangi.

Widia, Wiwi (2019) ANALISIS IMPLEMENTASI SYIRKAH PADA SKEMA EQUITY CROWDFUNDING DI PERUSAHAAN CARIMODAL. Sarjana thesis, Universitas Siliwangi.

Widiyani, Widiyani (2020) ANALISIS KINERJA MARKETING LENDING DALAM MENANGANI PEMBIAYAAN BERMASALAH PADA AKAD BAI’ BITSAMAN AJIL DI BMT DANA UKHUWAH CABANG CICALENGKA. Sarjana thesis, Universitas Siliwangi.

Wihda Nurhaliza, Hany (2019) PENGARUH PENDIDIKAN KEWIRAUSAHAAN DAN DUKUNGAN SOSIAL ORANGTUA TERHADAP INTENSI BERWIRAUSAHA MAHASISWA (Survey Pada Mahasiswa Jurusan Pendidikan Ekonomi Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

Wijayanti, Anggi (2021) ANALISIS SEKTOR UNGGULAN DAN KETIMPANGAN PENDAPATAN ANTAR KABUPATEN/KOTA DI PROVINSI JAWA TENGAH TAHUN 2010-2019. Sarjana thesis, Universitas Siliwangi.

Wildan, Muhamad (2021) ANALISIS DETERMINASI EKSPOR CENGKEH INDONESIA TAHUN 2005-2019. Sarjana thesis, Universitas Siliwangi.

Winarti, . (2019) PENGARUH LINGKUNGAN SEKOLAH DAN PERHATIAN ORANG TUA TERHADAP MOTIVASI BELAJAR SISWA (Survei pada Siswa SMA Muhammadiyah 1 Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Windriyana, - (2019) PENGARUH ROTASI, KOMUNIKASI KARYAWAN, LINGKUNGAN KERJA DAN GAYA KEPEMIMPINAN TERHADAP KEPUASAN KERJA (Sensus pada karyawan PT. Bank Danamon Indonesia Tbk Wilayah Priangan-Timur). Sarjana thesis, Universitas Siliwangi.

Wirazatnika, Fadila Prameswari (2021) EFEKTIVITAS PENGGUNAAN MEDIA SOSIAL SEBAGAI MEDIA PUBLIKASI PADA PRODUK SUKAHIJAB. Sarjana thesis, Universitas Siliwangi.

Wulandari, Herna (2019) ANALISIS FAKTOR-FAKTOR INTERNAL PRODUKSI BORDIR MANUAL DALAM MENINGKATKAN DAYA SAING PERUSAHAAN DI KECAMATAN KAWALU KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Wulandari, Wulandari (2020) PENGARUH PELATIHAN, STRES KERJA DAN PENGHARGAAN TERHADAP KINERJA KARYAWAN (Suatu Penelitian Terhadap Karyawan Departemen POSTRANS di PT. POS Indonesia (Persero) Cabang Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Wulansari, Rima (2018) MOTIF INTRINSIK DAN EKSTRINSIK TRANSAKSI KARYAWAN BANK SYARIAH DAN KARYAWAN BANK KONVENSIONAL (Studi Kasus Pada Karyawan Bank BJB Syariah Dan Karyawan Bank BJB Konvensional Di Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Y

YAKUB PIRDAUS, RIKI (2019) PENGARUH KONDISI SOSIAL EKONOMI KELUARGA TERHADAP MOTIVASI BELAJAR DAN IMPLIKASINYA TERHADAP PRESTASI BELAJAR SISWA (Survey Pada Siswa Kelas XI IPS SMA Negeri Se-Kabupaten Ciamis). Sarjana thesis, Universitas Siliwangi.

YANTI, MELY NOVIA ARI (2020) PENGARUH CORPORATE SOCIAL RESPONSIBILITY DAN RETURN ON ASSET TERHADAP PRICE TO BOOK VALUE (Survey Pada Index LQ 45 yang Terdaftar di Bursa Efek Indonesia 2014 -2018). Sarjana thesis, Universitas Siliwangi.

YOGI KHOERULLOH, MOHAMAD (2019) PENGARUH MODAL DAN JUMLAH TENAGA KERJA TERHADAP PRODUKSI INDUSTRI KELOM DI KECAMATAN TAMANSARI. Sarjana thesis, Universitas Siliwangi.

YOLANDA, DINDA TSANNY (2022) PERANAN CUSTOMER SERVICE DALAM PELAYANAN PRODUK DANA PADA PT. BANK TABUNGAN NEGARA (PERSERO) Tbk. KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

YUDISTIRA, YESI (2021) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI KEPUTUSAN PEMBELIAN PRODUK BUSANA MUSLIM (WANITA) RABBANI DI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

YULIAMEGASARI, WINDI (2020) PENGARUH PINJAMAN LUAR NEGERI, EKSPOR, NILAI TUKAR DAN PENANAMAN MODAL ASING TERHADAP PRODUK DOMESTIK BRUTO INDONESIA TAHUN 2004-2019. Sarjana thesis, Universitas Siliwangi.

YULIANA, ITA OKTAPIA (2021) ANALISIS IMPLEMENTASI PEMBIAYAAN PRODUK KPR DALAM MENINGKATKAN MINAT MASYARAKAT DI BANK BTN SYARIAH KCPS RUKO KALIMAS BEKASI TIMUR. Sarjana thesis, Universitas Siliwangi.

YULIANA DEWI, ASTI (2019) PENGARUH KEPEMIMPINAN GURU DAN KEMAMPUAN BERKOMUNIKASI GURU DI KELAS TERHADAP MOTIVASI BELAJAR MATA PELAJARAN EKONOMI PADA SISWA KELAS XI IIS MAN SE-KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

YUNIAWATI, YUNIAWATI (2020) PENGARUH BUDAYA KERJA, DISIPLIN DAN LINGKUNGAN TERHADAP SEMANGAT KERJA (Suatu Penelitian Pada Karyawan di Perusahaan X). Sarjana thesis, Universitas Siliwangi.

YUNINDA, ATHILLA (2019) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI KEUNTUNGAN PT. BPR CIPATUJAH JABAR PERSERODA 2008-2017. Sarjana thesis, Universitas Siliwangi.

YUNISA, DELLA (2021) ANALISIS POTENSI EKONOMI KABUPATEN PANGANDARAN TAHUN 2015-2019. Sarjana thesis, Universitas Siliwangi.

YUNISA, DELLA (2021) ANALISIS POTENSI EKONOMI KABUPATEN PANGANDARAN TAHUN 2015-2019. Sarjana thesis, Universitas Siliwangi.

YUNITA SARI SIALLAGAN, DIAN (2019) ANALISIS DETERMINAN KETIMPANGAN PENDAPATAN DI PROVINSI JAWA BARAT TAHUN 2008-2017. Sarjana thesis, Universitas Siliwangi.

YURISQA, YURISQA (2020) ANALISIS FLYPAPER EFFECT TERHADAP BELANJA DAERAH 2 KOTA DI JAWA BARAT TAHUN 2004-2018. Sarjana thesis, Universitas Siliwangi.

YURSILI, ALIVIA NURIL (2021) PENGARUH PENDAPATAN ASLI DAERAH, DANA ALOKASI UMUM, DAN DANA ALOKASI KHUSUS TERHADAP BELANJA MODAL PADA PEMERINTAH PROVINSI DI INDONESIA TAHUN 2010–2019. Sarjana thesis, Universitas Siliwangi.

YUSTIANA, EKA (2019) PENGARUH MODEL PEMBELAJARAN RECIPROCAL LEARNING BERBANTUKAN MEDIA LECTORA INSPIRE TERHADAP HASIL BELAJAR SISWA KELAS X IPS SMA NEGERII 1 JATIWARAS (Studi Quasi Eksperimen Pada Mata Pelajaran Ekonomi Kelas X IPS SMA Negeri 1 Jatiwaras Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

YUSUP, BAHARUDIN (2020) PENGARUH PROFITABILITAS DAN LEVERAGE TERHADAP ZAKAT PERUSAHAAN (Survei Pada Perbankan Syariah Di Indonesia Periode 2018). Sarjana thesis, Universitas Siliwangi.

Yanari Fitri, Nelly (2019) PENGARUH INOVASI PRODUK DAN DESAIN PRODUK TERHADAP PRODUKTIVITAS (Survei pada Perusahaan Kelom Geulis Sheny Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Yanti Aulia, Risma (2019) PENERAPAN MODEL PROBLEM BASED LEARNING BERBANTUKAN MEDIA SURAT KABAR DALAM MENINGKATKAN KEMAMPUAN PEMECAHAN MASALAH SISWA (Study Quasi Eksperimen pada kelas X IPS Tahun pelajaran 2018/2019 SMA Negeri 1 Taraju Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Yasin, Ibrahim Muhammad (2019) ANALISIS FAKTOR-FAKTOR PENYEBAB TERJADINYA PEMBIAYAAN BERMASALAH DI BMT AL-HIDAYAH SUTISNA SENJAYA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Yudiawati, Dais (2021) ANALISIS EFEKTIVITAS ENDORSEMENT PADA MEDIA SOSIAL INSTAGRAM DALAM PENINGKATAN PENJUALAN MUKENA YUMNA. Sarjana thesis, Universitas Siliwangi.

Yudiawati, Dais (2021) ANALISIS EFEKTIVITAS ENDORSEMENT PADA MEDIA SOSIAL INSTAGRAM DALAM PENINGKATAN PENJUALAN MUKENA YUMNA. Sarjana thesis, Universitas Siliwangi.

Yuliani, Windi (2022) ANALISIS STRATEGI PEMASARAN PADA UMKM SENTANA KABUPATEN CIAMIS. Sarjana thesis, Universitas Siliwangi.

Yusuf, Syutiawan (2021) ANALISIS EFEKTIFITAS PENYALURAN DANA ZAKAT PADA LEMBAGA PROGRAM BAZNAS MICRO FINANCE (BMF) DI BAZNAS KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Z

ZAHRA, SALSABILA FAUZIA (2022) FAKTOR-FAKTOR YANG MEMPENGARUHI KEPUTUSAN KONSUMEN DALAM MENGGUNAKAN JASA PENGIRIMAN J&T EXPRESS DI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

ZAKI MANGGALA PUTRA, MOHAMMAD (2019) PENGARUH ALIH FUNGSI LAHAN PERTANIAN DAN JUMLAH PENDUDUK TERHADAP KETAHANAN PANGAN BERAS KOTA TASIKMALAYA TAHUN 2012-2017. Sarjana thesis, Universitas Siliwangi.

ZAKIAH, FIKY NUR (2021) PENGARUH PENGELUARAN PEMERINTAH, PENANAMAN MODAL DALAM NEGERI, DAN PENANAMAN MODAL ASING TERHADAP PERTUMBUHAN EKONOMI INDONESIA TAHUN 2005-2019. Sarjana thesis, Universitas Siliwangi.

ZANAH, SARI NUR (2021) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI INDEKS HARGA SAHAM GABUNGAN (IHSG) INDONESIA TAHUN 2010-2019. Sarjana thesis, Universitas Siliwangi.

ZAQI, MUHAMAD (2019) ANALISIS SEKTOR UNGGULAN DI KABUPATEN SUKABUMI DENGAN MENGGUNAKAN ANALISIS LOCATION QUOTIENT DAN TIPOLOGI KLASSEN. Sarjana thesis, Universitas Siliwangi.

ZULFIANA, DINI (2019) PENGARUH BRAND IMAGE PERGURUAN TINGGI DAN LINGKUNGAN SEKOLAH TERHADAP MINAT MELANJUTKAN KE PERGURUAN TINGGI (Studi Kasus: Peserta Didik Kelas XII Sekolah Menengah Kejuruan Negeri 1 Karangpucung Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

Zahra, Ariffa Nuraini (2020) ANALISIS GAYA KEPEMIMPINAN DALAM MENINGKATKAN ETOS KERJA KARYAWAN KSPPS BMT WIRA MANDIRI TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Zakaria, Diki (2020) ANALISIS PREFERENSI WAKIF DALAM WAKAF BERUPA UANG DI LAZIS AGNIA CARE KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Zaki, Abdul Basith (2019) PENGARUH KUALITAS PELAYANAN TERHADAP KEPUASAN NASABAH LKMS BANK WAKAF RANAH INDAH DARUSSALAM CIAMIS. Sarjana thesis, Universitas Siliwangi.

Zanatin, Nadiya (2022) PROSEDUR PEMBUKAAN DAN PENCAIRAN DEPOSITO PADA PT BANK NEGARA INDONESIA (Persero) Tbk. KANTOR CABANG PEMBANTU SINGAPARNA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Zeinita, Rita (2019) ANALISIS PENDAPATAN ASLI DAERAH (PAD) DI PROVINSI JAWA BARAT (PeriodeTahun 2002 – 2017). Sarjana thesis, Universitas Siliwangi.

This list was generated on Wed Aug 10 19:15:54 2022 WIB.