Items where Subject is "H Social Sciences > HB Economic Theory"

Up a level
Export as [feed] Atom [feed] RSS 1.0 [feed] RSS 2.0
Group by: Creators | Item Type
Jump to: A | B | C | D | E | F | G | H | I | J | K | L | M | N | P | R | S | T | U | V | W | Y | Z
Number of items at this level: 358.

A

ABDUL AZIS, SEPTIAN (2019) ANALISIS PENGARUH PENANAMAN MODAL DALAM NEGERI (PMDN), PENANAMAN MODAL ASING (PMA), DAN BELANJA MODAL TERHADAP PERTUMBUHAN EKONOMI PROVINSI JAWA BARAT TAHUN 2007-2017. Sarjana thesis, Universitas Siliwangi.

ADHIYANI, DESI WULAN (2019) PENGARUH IKLIM ORGANISASI DAN STRES KERJA TERHADAP KINERJA DENGAN BURNOUT SEBAGAI VARIABEL INTERVENING (Sensus pada Perawat Pelaksana di Ruang Rawat Inap RSUD dr. Soekardjo Kota Tasikmalaya). Pascasarjana thesis, Universitas Siliwangi.

ADITIA, ANGGI (2019) PENGARUH SELF ESTEEM DAN KEMANDIRIAN BELAJAR TERHADAP PRESTASI BELAJAR MAHASISWA PENDIDIKAN EKONOMI ANGKATAN 2016 DAN ANGKATAN 2017 UNIVERSITAS SILIWANGI (Survei Pada Mahasiswa Pendidikan Ekonomi Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

ADJI, TSANY HILMYANA (2019) ANALISIS PENDAPATAN RUMAH MAKAN SEAFOOD DI KECAMATAN PANGANDARAN. Sarjana thesis, Universitas Siliwangi.

AGUSTIN, AZIS (2019) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI PRODUKSI IKAN KERAMBA JARING APUNG (KJA) DI WADUK CIRATA KABUPATEN CIANJUR. Sarjana thesis, Universitas Siliwangi.

AHMAD, USEP (2019) PENGARUH MODAL KERJA TERHADAP SISA HASIL USAHA (SHU) (Studi Kasus Pada KPRI Mustika Kecamatan Cisayong ) SKRIPSI Untuk Memenuhi Salah Satu Syarat Penulisan Skripsi Pada Program Studi Akuntansi Fakultas Ekonomi Oleh: USEP AHMAD 123403173 PROGRAM STUDI AKUNTANSI FAKULTAS EKONOMI UNIVERSITAS SILIWANGI TASIKMALAYA 2019. Sarjana thesis, Universitas Siliwangi.

AMANDA, REZA (2020) IMPLEMENTASI SERVICE EXCELLENT CUSTOMER SERVICE PT. BANK PERKREDITAN RAKYAT SILIWANGI CABANG CIBOGOR DALAM MENINGKATKAN PELAYANAN NASABAH. Diploma thesis, Universitas Siliwangi.

ANBAR FIRDAUS, DINDA (2019) PENGARUH PDB, KURS, INFLASI, DAN PAJAK TERHADAP PENANAMAN MODAL ASING DI INDONESIA TAHUN 2000-2017. Sarjana thesis, Universitas Siliwangi.

ANDANI, SARI (2019) PENERAPAN MODEL PEMBELAJARAN PROBLEM POSING DENGAN BANTUAN MEDIA PERMAINAN ULAR TANGGA UNTUK MENINGKATKAN HASIL BELAJAR SISWA (Studi Quasi Eksperimen Pada Mata Pelajaran Ekonomi Kelas X IPS SMA Negeri 6 Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

ANDRIAN SAPUTRA, YOGA (2020) PENGARUH DESKRIPSI KERJA, LINGKUNGAN KERJA DAN DISIPLIN KERJA TERHADAP STRES KERJA KARYAWAN. Sarjana thesis, Universitas Siliwangi.

ANDRIANI, MERLIN (2020) PENGARUH RETURN ON EQUITY (ROE), EARNING PER SHARE (EPS), DAN TOTAL ASSET TURNOVER (TATO) TERHADAP HARGA SAHAM (Pada PT. Ciputra Development, Tbk). Sarjana thesis, Universitas Siliwangi.

ANDRIYANA, ANDI (2018) PENGARUH KUALITAS PELAYANAN DAN PERSEPSI HARGA TERHADAP CITRA PERUSAHAAN (Studi Kasus Pada PO. Pariwisata Gapuraning Rahayu Ciamis). Sarjana thesis, Universitas Siliwangi.

ANGGRAENI, WIDYA (2019) PENGARUH PERSEPSI SISWA TENTANG KOMPETENSI GURU (KOMPETENSI PEDAGOGIK, PROFESIONAL, KEPRIBADIAN DAN KOMPETENSI SOSIAL) TERHADAP MINAT BELAJAR SISWA (Penelitian Survey Terhadap Siswa Kelas XI Pada Mata Pelajaran Ekonomi di SMA Negeri 1 Manonjaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

ARIANA, WINA (2019) PENGARUH JIWA WIRAUSAHA TERHADAP MINAT BERWIRAUSAHA PESERTA DIDIK KELAS XI SMK MITRA BATIK KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

ASRIADI, ADE RIZKI (2020) PENERAPAN GPN (GERBANG PEMBAYARAN NASIONAL) OLEH KANTOR PERWAKILAN BANK INDONESIA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

AULIA DEWI, RIVANI (2019) PENERAPAN MODEL PEMBELAJARAN KOOPERATIF TIPE COOPERATIVE SCRIPT DENGAN BANTUAN MEDIA POSTER DALAM MENINGKATKAN PEMAHAMAN KONSEP (Studi Kuasi Eksperimen pada Mata Pelajaran Ekonomi Kelas X MIPA SMA Negeri 1 Sindangkasih Ciamis Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

AWABIYANTI, DESITANIA (2019) ANALISIS TINGKAT EFISIENSI PRODUKSI AYAM BROILER DI KECAMATAN DAYEUHLUHUR. Sarjana thesis, Universitas Siliwangi.

AYU HARDIYANTI, INTAN (2019) ANALISIS KETIMPANGAN GENDER TERHADAP PERTUMBUHAN EKONOMI 4 PROVINSI DI PULAU JAWA TAHUN 2011-2017. Sarjana thesis, Universitas Siliwangi.

AZIZAH, SILMI FAUZIATUL (2020) PERAN KREDIT SERTIFIKASI DALAM MENINGKATKAN KUALITAS KREDIT DI PD. BPR ARTHA SUKAPURA KOTA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Adie Nugroho, Taufiq (2019) ANALISIS KINERJA CUSTOMER SERVICE DI PT. BANK BRI SYARIAH KC TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Adinda, Dewi Kamojang (2020) PENERAPAN PRINSIP 5C DALAM PEMBERIAN KREDIT PEMILIKAN RUMAH BTN PLATINUM PADA PT. BANK TABUNGAN NEGARA (PERSERO) Tbk. KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Agung Purnomo Aji, Mohamad (2020) ANALISI FAKTOR-FAKTOR YANG MEMPENGARUHI EKSPOR UDANG DI KABUPATEN CILACAP TAHUN 2001-2018. Sarjana thesis, Universitas Siliwangi.

Agustina, Dewi (2019) ANALISIS AKAD PEMBIAYAAN MUDHARABAH PADA SEKTOR UMKM DI KSPPS MITRA INSAN MANDIRI TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Ana Fatunnisa, Noor (2019) PERBANDINGAN MODEL PEMBELAJARAN PROBLEM BASED LEARNING DENGAN CREATIVE PROBLEM SOLVING DALAM MENINGKATKAN KEMAMPUAN BERPIKIR ANALITIS PESERTA DIDIK (Studi Quasi Eksperimen pada Mata Pelajaran Ekonomi Kelas XI IPS MA Negeri 2 Kota Tasikmalaya Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

Andriani, Dina (2020) ANALISIS DAMPAK LEGALITAS DAN LABELISASI HALAL DALAM PENGEMBANGAN UMK OLAHAN MAKANAN DI KEC.CIPAKU KAB.CIAMIS. Sarjana thesis, Universitas Siliwangi.

Anggraeni, Anggi (2019) PENERAPAN MODEL PEMBELAJARAN KOOPERATIF TIPE STUDENT FACILITATOR AND EXPLAINING (SFE) TERHADAP PEMAHAMAN KONSEP PESERTA DIDIK (Studi Quasi Eksperimen pada Mata Pelajaran Ekonomi Kelas X IPS SMA Negeri 3 Tasikmalaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

Anggretya Yuniarti, Dita (2020) PROSEDUR PELAKSANAAN PEMBERIAN KREDIT BNI FLEKSI PADA PT. BANK NEGARA INDONESIA (PERSERO) Tbk. KANTOR CABANG PEMBANTU CIKURUBUK KOTA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Anisa, Ade (2019) PENGARUH PRODUKSI KEDELAI, KONSUMSI KEDELAI NASIONAL DAN IMPOR KEDELAI TAHUN SEBELUMNYA, LAJU PERTUMBUHAN EKONOMI SERTA HARGA KEDELAI DOMESTIK TERHADAP IMPOR KEDELAI DI INDONESIA TAHUN 2003-2017. Sarjana thesis, UNIVERSITAS SILIWANGI.

Anisa Maknun, Lulu (2019) PENGARUH KUALITAS PRODUK DAN KUALITAS PELAYANAN TERHADAP PREFERENSI NASABAH TABUNGAN IB MASLAHAH INSTAN DI BANK JABAR BANTEN SYARIAH KCP CIKURUBUK TASIKMALAYA. Sarjana thesis, UNIVERSITAS SILIWANGI.

Antania, Antania (2020) ANALISIS PENERIMAAN DEVISA PARIWISATA INDONESIA TAHUN 2008-2018. Sarjana thesis, Universitas Siliwangi.

Ardianty, Anggita (2019) ANALISIS PENGUKURAN KUALITAS PELAYANAN BANK SYARIAH DENGAN METODE FUZZY-SERVQUAL DIMENSI CARTER (Studi Kasus pada Bank BJB Syariah Kantor Cabang Tasikmalaya). Diploma thesis, Universitas Siliwangi.

Arika, Deki (2019) PENERAPAN MODEL PEMBELAJARAN KOOPERATIF TIPE TEAMS GAMES TOURNAMENT DENGAN BANTUAN MEDIA TEKA-TEKI SILANG DALAM MENINGKATKAN PRESTASI BELAJAR SISWA (Studi Kuasi Eksperimen Pada Siswa Kelas XI IPS MAN 7 Kabupaten Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Arip Nurjaman, Ujang (2020) TINJAUAN AKAD IJARAH iB HASANAH CARD PADA PT. BANK BNI SYARIAH KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Aslam Fikri, Muhammad (2019) ANALISIS PENGEMBANGAN USAHA DENGAN BUSINESS MODEL CANVAS PADA STARTUP EO SAVANA PLANNER TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Atorid Mahmud, Zainal (2019) PENGARUH KEPEMIMPINAN DAN MOTIVASI TERHADAP IMPLEMENTASI STRATEGI SERTA IMPLIKASINYA TERHADAP KINERJA (Survei Pada Pegawai Perusahaan Daerah Air Minum Tirta Sukapura Kabupaten Tasikmalaya). Pascasarjana thesis, Universitas Siliwangi.

Awaliyah, Syifatul (2020) PENGARUH LOAN TO DEPOSIT RATIO, DAN EARNING PER SHARE TERHADAP RETURN SAHAM (Pada PT. Bank Rakyat Indonesia (Persero) Tbk). Sarjana thesis, Universitas Siliwangi.

Azmi Ulfaz, Muhammad (2019) PENGARUH LINGKUNGAN KELUARGA TERHADAP MOTIVASI BERWIRAUSAHA MAHASISWA PENDIDIKAN EKONOMI (Survei Pada Mahasiswa Pendidikan Ekonomi Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

A’LAWI, ARSAL (2019) PENGARUH MODAL, TENAGA KERJA DAN BAHAN BAKU TERHADAP NILAI PRODUKSI (Studi Kasus pada Industri Meubel di Kecamatan Cibeureum Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

B

BAGAS BAHARI CAHYANA, RADEN (2020) PENGARUH MOTIVASI KERJA, BUDAYA KERJA, DAN KESELAMATAN KESEHATAN KERJA (K3) TERHADAP KINERJA KARYAWAN (Survey Pada Karyawan Non Manajerial Pada PT. Lottemart Whosale Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

BERLINA, AYU (2020) PROSEDUR PENCEGAHAN FRAUD DALAM PERKREDITAN PADA BANK WOORI SAUDARA KANTOR CABANG PEMBANTU GUNUNG SABEULAH KOTA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Badruzaman, Jajang (2014) ANALISIS PERENCANAAN & PERTUMBUHAN KEUANGAN MELALUI PENDEKATAN NERACA PROFORMA. Hasil Reviewer, 9 (2). pp. 105-114. ISSN 1907 - 9958

Badruzaman, Jajang (2015) ANALYSIS COMPARATIF OF NON PERFORMANCE FINANCING BEFORE AND AFTER PUBLISHED OF FATWA NUMBER 84/DSNMUI/ XII/2012 AT SHARIA BANKING (Census Of Four Sharia Banking At Tasikmalaya). Hasil Reviewer. pp. 5-22. ISSN 978-602-1004-12-8

Badruzaman, Jajang (2019) Analysis Relative Strength Index and Earning Per Share on Stock Price. Hasil Reviewer, 12 (4). pp. 1-9. ISSN 2456-639X

Badruzaman, Jajang Analysis of Asset Growth and Profit Growth Through Supply Chain Management Toward Company Value. Korespondensi.

Badruzaman, Jajang (2019) Analysis of Comparison of Stock Prices before and After Announcement of Business-27 Indks (Census on Companies in the Category of Business Index 27 in 2018). Hasil Reviewer, 4 (7). pp. 592-595. ISSN 2415 6663 (print) ISSN 2415 6671 (online)

Badruzaman, Jajang (2019) EFFECT OF CAPITAL STRUCTURE ON RETURN ON EQUITY: A SURVEY ON ISSUERS OF CATEGORIES JII70 OF THE INDONESIA STOCK EXCHANGE. Hasil Reviewer, 5 (89). pp. 242-246. ISSN 242-246

Badruzaman, Jajang (2020) The Effect of Payout Ratio Dividend and Earning Volatility on Stock Price (In the 2014-2017 BEI Manufacturing Company). Saudi Journal of Economics and Finance, 4 (7). pp. 326-334. ISSN 2523-6S63

Badruzaman, Jajang THE IMPACT OF EARNING PER SHARE AND RETURN ON EQUITY ON STOCK PRICE. Hasil Uji Kemiripan.

Badruzaman, Jajang (2020) The Influence of Return on Equity and Price Earnings Ratio to ward Price to Book Value. Hasil Reviewer, 82. pp. 13057-13061. ISSN 0193-4120

Badruzaman, Jajang (2012) PENGARUH BUDAYA ORGANISASI DAN ORGANIZATION CITIZENSHIP BEHAVIOUR (OCB) TERHADAP KUALITAS LAYANAN (Studi kasus pada Rumah Sakit Umum Daerah Kota Tasikmalaya). Hasil Reviewer, 6 (2). pp. 66-91. ISSN 1907-9958

Badruzaman, Jajang (2014) PENGARUH DUKUNGAN PIMPINAN DAN KOMPETENSI STAF AKUNTANSI TERHADAP PENERAPAN GOOD GOVERNANCE SERTA DAMPAKNYA TERHADAP KUALITAS INFORMASI AKUNTANSI KEUAN. Hasil Reviewer, 9 (1). pp. 67-86. ISSN 1907 - 9958

Badruzaman, Jajang (2010) PENGARUH PENGAWASAN INTERN TERHADAP KINERJA KOPERASI (SENSUS PADA KUD DI KOTA TASIKMALAYA). Hasil Reviewer, 2 (1). pp. 95-114. ISSN 2058-7055

Badruzaman, Jajang (2010) Pengaruh Corporate Social Responsibility Disclosure Terhadap Pertumbuhan Perusahaan. Hasil Reviewer, 5 (2). pp. 107-117. ISSN 1907-1442

Badruzaman, Jajang (2013) Pengaruh Debt To Equity Ratio Dan Return On Equity Terhadap Earning Per Share. Hasil Reviewer, 8 (2). pp. 272-283. ISSN 1907 - 9958

Badruzaman, Jajang (2014) Pengaruh Dukungan Pimpinan Dan Kompetensi Staf Akuntansi Terhadap Penerapan Good Governance Serta Dampaknya Terhadap Kualitas Informasi Akuntansi Keuangan Daerah. Hasil Reviewer, 9 (1). pp. 67-86. ISSN 1907 - 9958

Badruzaman, Jajang (2017) Pengaruh Earning Per Share Terhadap Harga Saham. Hasil Reviewer, 12 (1). pp. 101-110. ISSN 1907 - 9958

Badruzaman, Jajang (2018) STOCK PRICE ANALYSIS BEFORE AND AFTER THE ISSUANCE OF FINANCIAL STATEMENTS: SURVEY ON BASIC AND CHEMICAL INDUSTRIES AT INDONESIA STOCK EXCHANGE. Hasil Reviewer, 8 (80). pp. 26-30. ISSN 2226-1184

Badruzaman, Jajang and Chairunnisa, Irna (2012) PENGARUH IMPLEMENTASI SISTEM AKUNTABILITAS KINERJA INSTANSI PEMERINTAH (SAKIP) TERHADAP PENERAPAN GOOD GOVERNANCE (Sensus pada 14 Dinas Daerah di Pemerintah Kabupaten Ciamis). Hasil Reviewer, 7 (1). pp. 57-70. ISSN 1907-3771

Badruzaman, Jajang and Chairunnisa, Irna (2012) Pengaruh Implementasi Sistem Akuntabilitas Kinerja Instansi Pemerintah (SAKIP) Terhadap Penerapan Good Governance. Jurnal Nasional Terakrditasi, 7 (1). pp. 57-70. ISSN 1907-3771

Badruzaman, Jajang and Kusmayadi, Dedi (2014) Akuntansi Hotel. Hasil Reviewer. pp. 1-118. ISSN 978-602-99904-7-8

Badruzaman, Jajang and Kusmayadi, Dedi (2017) Dividend payout ratio influence To wards stock price (Survey of The Firm LQ 45 Listed in Indonesian Stock Exchange). Hasil Reviewer, 23 (9). pp. 773-784. ISSN 8793-8795

Badruzaman, Jajang and Kusmayadi, Dedi (2014) Model of Good Financial Governance in Badan Amil Zakat Tasikmalaya. Hasil Reviewer. pp. 67-84. ISSN 978-979-9204-99-8

Badruzaman, Jajang and Nurleli, Leli (2013) PENGARUH INSENTIF TERHADAP PRODUKTIVITAS TENAGA KERJA DAN DAMPAKNYA PADA PROFITABILITAS PERUSAHAAN. Hasil Reviewer, 8 (1). 184 -197. ISSN 1907 - 9958

Badruzaman, Jajang and Nurleli, Leli (2013) Pengaruh Insentif terhadap Produktivitas Tenaga Kerja dan Dampaknya pada Profitabilitas Perusahaan. Jurnal Nasional, 8 (1). pp. 184-197. ISSN 1907 - 9958

Badruzaman, Jajang and Nurleli, Leli (2012) Pengaruh Insentif terhadap Produktivitas Tenaga Kerja dan Dampaknya pada Profitabilitas Perusahaan. Hasil Reviewer, 8 (1). pp. 184-197. ISSN 1907 - 9958

Badruzaman, Jajang and Pelitawati, Tita (2011) PENGARUH LINGKUNGAN KERJA TERHADAP MOTIVASI DAN KOORDINASI SERTA DAMPAKNYA TERHADAP KINERJA PEGAWAI (Sensus Terhadap Pegawai Struktural Eselon IV Pada Kantor Kelurahan dan Kecamatan Kota Tasikmalaya). Hasil Reviewer, 6 (1). pp. 675-687. ISSN 1907-9958

Badruzaman, Jajang and Ramdhani, Ridwan (2011) HUBUNGAN INVESTMENT OPPORTUNITY SET (IOS) HUBUNGAN INVESTMENT OPPORTUNITY SET (IOS) PADA HARGA SAHAM DENGAN SALES GROWTH PERUSAHAAN DI BURSA EFEK INDONESIA (Survey pada Perusahaan Manufaktur yang Listing di BEI). Hasil Reviewer, 3 (2). pp. 597-609. ISSN 2086-2563

Badruzaman, Jajang and Ridho, Adil and Saputra, Jumadil (2019) Analysis of Asset Growth and Profit Growth Through Supply Chain Management Toward Company Value. Hasil Reviewer, 8 (5). pp. 336-348. ISSN 2050-7399 (Online), 2051-3771 (Print)

Badruzaman, Jajang and Ridho, Adil and Saputra, Jumadil (2019) Analysis of Asset Growth and Profit Growth Through Supply Chain Management Toward Company Value. Hasil Reviewer, 8 (5). pp. 336-348. ISSN 2050-7399 (Online), 2051-3771 (Print)

Badruzaman, Jajang and Sugiarti, Rini (2010) PENGARUH RETURN ON INVESTMENT TERHADAP DEVIDED PAYOUT RATIO DAN DAMPAKNYA PADA VOLUME PERDAGANGAN SAHAM. Hasil Reviewer, 5 (1). pp. 392-412. ISSN 1907-9958

Bahtiar, Ade (2020) EFISIENSI PRODUKSI TERNAK AYAM PETELUR DI HC FARM KECAMATAN CIAWI KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Barduzaman, Jajang (2020) Analisis Efisiensi dan Kinerja Syariah di Indonesia. JURNAL AKUNTANSI, 15 (1). pp. 20-27. ISSN 1907-9958

Budiman, Ihsan (2019) PENGARUH CURRENT RATIO DAN STRUKTUR MODAL TERHADAP RETURN ON ASSET (ROA) (Survei pada Sektor Makanan dan Minuman yang Terdaftar di Bursa Efek Indonesia Tahun 2015-2017). Sarjana thesis, Universitas Siliwangi.

C

CHAERANI, NADIA (2019) PENGARUH PENDAPATAN ASLI DAERAH (PAD), DANA PERIMBANGAN DAN PENANAMAN MODAL DALAM NEGERI (PMDN) TERHADAP PRODUK DOMESTIK REGIONAL BRUTO (PDRB) DI PULAU JAWA. Sarjana thesis, Universitas Siliwangi.

CLARA TAMI, RINDA (2017) PENGARUH PAJAK DAERAH DAN RETRIBUSI DAERAH TERHADAP PENDAPATAN ASLI DAERAH (Studi Kasus Pada Pemerintah Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Cahya Lestari, Vita (2021) PENGARUH PENDIDIKAN KEWIRAUSAHAAN, LOCUS OF CONTROL DAN SELF EFFICACY TERHADAP NIAT BERWIRAUSAHA MAHASISWA. Sarjana thesis, Universitas Siliwangi.

Chika Nuroktaviani, Cucu (2019) PENERAPAN MODEL PEMBELAJARAN TREFFINGER DENGAN BANTUAN MEDIA POWER POINT DALAM MENINGKATKAN KEMAMPUAN BERPIKIR KREATIF SISWA (Studi Kuasi Eksperimen Pada Siswa Kelas XI IPS Pada Mata Pelajaran Prakarya/Kewirausahaan di SMA Negeri 1 Kota Tasikmalaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

D

DAFFA ROBIANI, ANNISA (2020) TINJAUAN PELAKSANAAN PROMOSI KREDIT UMUM PENSIUNAN (KUPEN) PADA PT. BANK WOORI SAUDARA INDONESIA 1906, Tbk. KANTOR CABANG PEMBANTU (KCP) MANONJAYA. Diploma thesis, Universitas Siliwangi.

DAMAYANTI, KIKI (2019) PENGARUH STATUS SOSIAL EKONOMI ORANG TUA DAN TEMAN SEBAYA TERHADAP GAYA HIDUP HEDONISME MAHASISWA (Survei Pada Mahasiswa Jurusan Pendidikan Ekonomi Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

DARMAWAN, ADI (2019) PENGARUH KUALITAS KEHIDUPAN KERJA DAN PENGEMBANGAN KARIER TERHADAP KINERJA KARYAWAN (Penelitian Pada Staff Di PT. PLN (Persero) Area Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

DWI ASTIANI, NIDYA (2018) PENERAPAN MODEL PEMBELAJARAN CREATIVE PROBLEM SOLVING (CPS) UNTUK MENINGKATKAN KEMAMPUAN BERPIKIR KREATIF PESERTA DIDIK PADA MATA PELAJARAN EKONOMI (Studi Quasi Eksperimen Pada Mata Pelajaran Ekonomi Kelas XI SMA Negeri 4 Tasikmalaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

DWI RAHMAWATI, NINDI (2019) PENGARUH LINGKUNGAN KELUARGA DAN LINGKUNGAN MASYARAKAT TERHADAP PRESTASI BELAJAR (Survei Pada Mata Pelajaran Ekonomi Siswa Kelas XI IPS SMA Negeri 1 Cihaurbeuti). Sarjana thesis, Universitas Siliwangi.

Deris, Margana (2019) PENGARUH LINGKUNGAN SEKOLAH DAN LINGKUNGAN KELUARGA TERHADAP DISIPLIN BELAJAR PESERTA DIDIK (Penelitian Survei Terhadap Peserta Didik Kelas XI SMA Negeri 8 Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Dian Rizqi Muzaqqi, Muhammad (2019) ANALISIS EFEKTIVITAS PROGRAM FUNDRAISING PADA GERAI PELAYANAN ZAKAT DI DAARUT TAUHIID PEDULI PRIANGAN TIMUR. Sarjana thesis, Universitas Siliwangi.

Dinahastuti, Dini and Badruzaman, Jajang and -, Wursan (2019) Effect of Capital Asset Pricing Model on Stock Prices. Hasil Uji Kemiripan, 13 (3). pp. 1-11. ISSN 2456-639X

E

ELI LIFARAWATI, ARVIYANA (2019) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI KEPUTUSAN PEMBELIAN SECARA ONLINE PADA MAHASISWA PENDIDIKAN EKONOMI UNIVERSITAS SILIWANGI (Studi Kasus Konsumen Online pada Mahasiswa Pendidikan Ekonomi 2015-2018). Sarjana thesis, universitas siliwangi.

F

FACHRIJAL, MAULANA FAJAR (2019) PENGARUH PRODUK HARGA DAN PROMOSI TERHADAP KEPUTUSAN PEMBELIAN (Survey Pada Konsumen CV. Aksepindo Pratama Jakarta Pusat). Pascasarjana thesis, Universitas Siliwangi.

FADILAH, JIHAN (2021) PENGARUH HARGA, LABELISASI HALAL, KUALITAS PRODUK, DAN BRAND TRUST TERHADAP LOYALITAS PELANGGAN (Studi Kasus pada Konsumen PIXY di Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

FAHMI, WANDARA (2019) PENGARUH PENDIDIKAN, PENGANGGURAN, DAN PERTUMBUHAN EKONOMI TERHADAP TINGKAT KEMISKINAN DI INDONESIA TAHUN 2004-2018. Sarjana thesis, Universitas Siliwangi.

FATHIYYAH NURJANAH, MITA (2021) ANALISIS CAPAIAN PROGRAM KERJA PEMBANGUNAN DESA DI KECAMATAN JAMANIS TAHUN 2015-2019. Sarjana thesis, Universitas Siliwangi.

FAUJIAH, FUJA (2019) PENERAPAN MODEL PEMBELAJARAN KOOPERATIF TIPE TWO STAY TWO STRAY UNTUK MENINGKATKAN HASIL BELAJAR SISWA (Studi Eksperimen Pada Mata Pelajaran Ekonomi Kelas XI IPS SMAN 1 Cihaurbeuti Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

FAUZI, DENI (2020) Pengaruh Kelengkapan Produk, Harga dan Periklanan Terhadap Kepuasan Konsumen (Penelitian di Gudang Cell Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

FAUZI IDRIS, EZZA (2019) ANALISIS PENYERAPAN TENAGA KERJA PADA INDUSTRI PAVING BLOCK DI KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

FAUZIAH, ULFA (2018) PENGARUH LINGKUNGAN SEKOLAH DAN KETERAMPILAN MENGAJAR GURU TERHADAP MINAT BELAJAR SISWA PADA MATA PELAJARAN EKONOMI DI KELAS IPS SMA TERPADU RIYADLUL ULUM. Sarjana thesis, Universitas Siliwangi.

FEBBY FATHUR RACHMAN, MUHAMMAD (2019) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI KEUNTUNGAN PERUSAHAAN MEBEL (STUDI KASUS DI KECAMATAN TAWANG KOTA TASIKMALAYA TAHUN 2019). Sarjana thesis, Universitas Siliwangi.

FEBBYRIANTI, VIMPI SILVIE (2019) PROSEDUR PENANGANAN PEMBIAYAAN BERMASALAH PRODUK KPR SEJAHTERA iB PT. BANK TABUNGAN NEGARA (Persero) Tbk. KANTOR CABANG SYARIAH TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

FEBBYRIANTI, VIMPI SILVIE (2020) PROSEDUR PENANGANAN PEMBIAYAAN BERMASALAH PRODUK KPR SEJAHTERA iB PT. BANK TABUNGAN NEGARA (Persero) Tbk. KANTOR CABANG SYARIAH TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

FEBRIANI, RIFA (2019) PERBANDINGAN PENGGUNAAN MEDIA PEMBELAJARAN KOMIK DAN POSTER DENGAN MODEL PEMBELAJARAN PROBLEM BASED LEARNING TERHADAP HASIL BELAJAR (Studi Quasi Eksperimen Peserta Didik pada Mata Pelajaran Ekonomi Kelas XI IPS di SMA Negeri 1 Sindangkasih). Sarjana thesis, Universitas Siliwangi.

FIKRI, ZAELANI (2019) PENGARUH KUALITAS PRODUK DAN HARGA TERHADAP KEPUTUSAN PEMBELIAN FASHION MUSLIM ONLINE (Survey Pada Mahasiswa Fakultas Agama Islam Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

FIRDAUS, FIRMAN MUHAMAD (2019) PENGARUH CURRENT RATIO, DEBT TO EQUITY RATIO, DAN RECEIVABLE TURN OVER TERHADAP RETURN ON ASSET PADA PT. KIMIA FARMA, TBK. Sarjana thesis, Universitas Siliwangi.

FIRDAUS, ZULFIAN (2018) PENGARUH MOTIVASI DAN MINAT BELAJAR TERHADAP HASIL BELAJAR SISWA SMP NEGERI 8 KOTA TASIKMALAYA (Penelitian Survei terhadap Siswa Kelas VIII Tahun Pelajaran 2017/2018 di SMP Negeri 8 Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

FISESAH, HERDIS (2015) PENGARUH CUSTOMER SERVICE, RESPONSIVENESS DAN EMPATHY TERHADAP KEPUASAN PENGUNJUNG HOTEL KRISNA BEACH PANGANDARAN. Sarjana thesis, Universitas Siliwangi.

FITRIANI, RESA (2021) ANALISIS ETIKA BISNIS ISLAM PADA TOKO MEDIRA TOYS GUNUNG KALONG KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

FUJI HENDRIANI, SANITA (2018) PENERAPAN MODEL PEMBELAJARAN KOOPERATIF TIPE THINK PAIR AND SHARE (TPS) DENGAN ALAT BANTU MEDIA PETA KONSEP DALAM MENINGKATKAN HASIL BELAJAR SISWA ( Studi Quasi Eksperimen Pada Mata Pelajaran Ekonomi Kelas X-MIA MA Negeri 1 Tasikmalaya Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

Fadil Nurpuadi, Ahmad (2018) PENERAPAN MODEL PEMBELAJARAN GUIDED INQUIRY DALAM MENINGKATKAN KEMAMPUAN BERPIKIR KRITIS SISWA (Studi Kuasi Eksperimen pada Mata Pelajaran Ekonomi Kelas XI IPS SMA Negeri 4 Tasikmalaya Tahun Pelajaran 2017/2018). Sarjana thesis, Universitas Siliwangi.

Fauziah, Hilda (2019) PENGARUH KEMASAN DAN KUALITAS PRODUK TERHADAP DAUR HIDUP PRODUK MAKANAN OLAHAN DI MAMBO KULINER NITE KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Fauziah, Wulan (2020) ANALISIS STRATEGI DISTRIBUSI DALAM MEMPERTAHANKAN SIKLUS DAUR HIDUP PRODUK DI ASHIFA COLLECTIONS TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Firmansyah, Irman and Marlina, Lina and Nasrulloh, Agus Ahmad (2015) Model Pengembangan Wirausaha Kreatif Berbasis Syariah di Kota Tasikmalaya Melalui Pendekatan Metode ANP (Prosiding Seminar Nasional seri ke-5 Menuju Masyarakat Madani dan Lestari. Prosiding Seminar Nasional seri ke-5 Menuju Masyarakat Madani dan Lestari, Direktorat Penelitian dan Pengabdian Masyarakat Universitas Islam Indonesia. pp. 113-130.

Fitrianda, Linda (2020) ANALISIS FAKTOR PRODUKSI ANYAMAN PANDAN DI RAJAPOLAH (Studi Kasus Pada Usaha Kerajinan Anyaman Pandan Di Kecamatan Rajapolah). Sarjana thesis, Universitas Siliwangi.

Furwaningsih, Fauziah (2018) PENGARUH LINGKUNGAN SOSIAL SEKOLAH TERHADAP MOTIVASI BELAJAR SISWA PADA MATA PELAJARAN EKONOMI (Survey pada Siswa-siswi IPS SMA Negeri 7 Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

G

GHINAWATI, AULIA DWI (2020) STAREGI PENYELESAIAN KREDIT MACET DI PD. BPR ARTHA SUKAPURA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

GILANG PUSPITASARI, ADE (2019) ANALISIS PERBANDINGAN KINERJA KEUANGAN PERUSAHAAN SEBELUM DAN SESUDAH MERGER DAN AKUISISI PADA PT. XL AXIATA, TBK. PERIODE 2011-2017. Sarjana thesis, Universitas Siliwangi.

GINANJAR, YUDI (2018) PERBANDINGAN MODEL PEMBELAJARAN GROUP INVESTIGATION DAN PROBLEM BASED LEARNING TERHADAP KEMAMPUAN BERFIKIR KREATIF SISWA (Studi Quasi Eksperimen pada Mata Pelajaran Ekonomi Bisnis Kelas X OTKP SMK Sukapura Kab. Tasikmalaya Tahun Pelajran 2018/2019) SKRIPSI Diajukan Untuk Memenuhi Salah Satu Syarat Dalam Memperoleh Gelar Sarjana Pendidikan. Sarjana thesis, Universitas Siliwangi.

GUNAWAN, ARDI (2019) ANALISIS PENGENDALIAN PERSEDIAAN BARANG JADI DI PT. VICTORIA CARE INDONESIA. Sarjana thesis, Universitas Siliwangi.

Gunawan, Tia Lisiani Tri (2020) PROSEDUR PEMBAYARAN DANA PENSIUN SECARA TUNAI DAN TRANSFER PADA PT. TASPEN (PERSERO) KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Gunawan, Tia Lisiani Tri (2020) PROSEDUR PEMBAYARAN DANA PENSIUN SECARA TUNAI DAN TRANSFER PADA PT. TASPEN (PERSERO) KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

H

HAMDAYANI, AAM (2019) PENGARUH PEMBERIAN REWARD AND PUNISHMENT TERHADAP MOTIVASI SERTA IMPLIKASINYA TERHADAP PRESTASI BELAJAR MATA PELAJARAN EKONOMI KELAS XI MAN 2 TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

HAMIDAH NUR ROHMAH, HEMI (2019) PENGARUH LINGKUNGAN KELUARGA TERHADAP MINAT MELANJUTKAN PENDIDIKAN KE PERGURUAN TINGGI DI SMA NEGERI 10 TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

HANDAYANI SITANGGANG, DEVI (2019) ANALISIS INFLASI DI INDONESIA TAHUN 2008-2018. Sarjana thesis, Universitas Siliwangi.

HASANUDIN BUDIANA, DIAN (2019) PENGARUH PENGAWASAN INTERNAL, PERENCANAAN KEUANGAN DESA, KOMPETENSI APARATUR DESA, KOMITMEN ORGANISASI DAN PARTISIPASI ANGGARAN TERHADAP KINERJA KEUANGAN PEMERINTAH DESA DI KAB. TASIKMALAYA (Sensus pada 5 Kecamatan : Cisayong, Sukahening, Sukaratu, Rajapolah dan Jamanis). Pascasarjana thesis, UNIVERSITAS SILIWANGI.

HERDIANA, HERDIANA (2018) PENGARUH IMPLEMENTASI SISTEM MERIT TERHADAP KINERJA PEGAWAI NEGERI SIPIL (Penelitian pada Sekretariat Daerah Kota Tasikmalaya). Pascasarjana thesis, Universitas Siliwangi.

HERLIYANI, LINA (2019) PENGARUH SUPERVISI AKADEMIK DAN MOTIVASI KERJA TERHADAP KINERJA GURU EKONOMI SMA/MA NEGERI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

HIDAYAT, MUHAMMAD (2020) PROSEDUR PEMBERIAN KREDIT PENSIUN HYBRID PADA PT. BANK WOORI SAUDARA INDONESIA 1906, Tbk KANTOR CABANG PEMBANTU CIAMIS. Diploma thesis, Universitas Siliwangi.

HIDAYAT, RIKI (2019) PENGARUH PENGETAHUAN PERKOPERASIAN DAN KEMAMPUAN MANAJERIAL PENGURUS TERHADAP PARTISIPASI ANGGOTA KOPERASI SISWA (Survei Pada Koperasi Siswa MAN 1 Kabupaten Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Hasanah, Uswatun (2019) PENGARUH LINGKUNGAN SEKOLAH DAN MOTIVASI BELAJAR TERHADAP HASIL BELAJAR SISWA (Survey Terhadap Siswa Peminatan IPS Pada Mata Pelajaran Ekonomi di SMA Muhammadiyah Kota Tasikmalaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

Hasnara, Gita (2019) PENGARUH LINGKUNGAN SEKOLAH DAN GAYA BELAJAR TERHADAP PRESTASI BELAJAR PESERTA DIDIK (Survei Pada Peserta Didik Kelas X dan XI di SMA Negeri 3 Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Hastulis Lestari Komarlina, Dwi and Wahyu, Budhi (2012) Analisis Potensi Kerajinan Industri Makanan Olahan di Kabupaten Tasikmalaya. JURNAL ILMU EKONOMI, 2 (1). pp. 288-310. ISSN 2301-8828

Hastuti Lestari Komarlina, Dwi Analisi Faktor-Faktor yang Mempengaruhi Inflasi di ndonesia Tahun 2000-2014. Jurnal Nasional.

Hastuti Lestari Komarlina, Dwi Analisi Pengaruh Variabel Moneter terhadap Harga Saham Properti Indonesia ( Manggunkan Uji Engle-Granger Error Correction Model. EG-ECM.0 (1). Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi Analisis Ekspor Teh di Indonesi Periode Tahun 1990-2008. Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi Analisis Ekspor Teh di Indonesi Periode Tahun 1990-2008. Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi Analisis Faktor Penentu Pertumbuhan Ekonomi dan Kebutuhan Investasi di Jawa Barat Tahun 2002-2011. Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi Analisis Potensi Kerajinan Industri Makanan Olahan di Kabupaten Tasikmalaya. Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi Analisisi Kinerja Keuangan dan Kesehatan Perusahaan Daerah Pasar Resik Kota Tasikmalaya. Hasil Reviewerl.

Hastuti Lestari Komarlina, Dwi Analytical Hierarchy Process (AHP). Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi (ITGbM) Pelatihan Pengolahan Makanan Berbahan Baku Lokal; Model Pemberdayaan Perempuan dalam Pengembagan Wisata Kuliner di Kawasan Wisata Jojongan Desa Kecam. Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi (ITGbM) Pengembangan Jaringan Pasar Produk Lebah Madu di Desa Cintaratu Kecamatan Paringi Kabupaten Pangandaran. Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi (IbID) Pelatihan Menghias Kue Tart dan Hantaran Seserahan; Model Pemberdayaan Permpuan dalam Penigkatan Kesejahteraan Keluarga di Desa Cintaratu dan Cintakarya Kecamatan Pariri Kabupaten Pangandaran. Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi MEASUREMENT OF TOURIST SATISFACTION BASED ON BEACH ATTRACTION PRODUCT ATTRIBUTES. Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi Market-Segmentation-Targeting-Strategy-And-Positioning-Strategy-Performance-Effects-To-The-Tourists-Satisfaction-research-In-Pangandaran-Beach-Pangandaran District). Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi Pengaruh Inflasi, Tenaga Kerja dan Kurs Terhadap Investasi di Provinsi Jawa Barat (1). Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi Pengaruh Inflasi, Tenaga Kerja dan Kurs Terhadap Investasi di Provinsi Jawa Barat (1). Hasil Reviewer.

Hastuti Lestari Komarlina, Dwi Pengaruh Kualitas Pelayanan terhadap Kepuasan Pemakai Kios Pasar di UPTD Koperasi dan Pasar Guntur Ciawitali Kabupaten Garut (2). Jurnal Nasional.

Hastuti Lestari Komarlina, Dwi and Budi, Chandra (2011) Analisis Pengaruh Variabel Moneter terhadap Harga Saham Properti Indonesia (Menggunakan Uji Engel-Granger Error Correction Model . Eg-Ecm.). JURNAL ILMU EKONOMI, 1 (1). pp. 1-16. ISSN 2301-8828

Hastuti Lestari Komarlina, Dwi and Kadarisman, Encang and Abdul Rohman, Aab (2016) Pengaruh Pengeluaran Pemerintah dan PDRB terhadap PAD Provinsi Jawa Barat (1). JURNAL ILMU EKONOMI, 6 (2). ISSN 2301-8828

Herawati, Erma (2020) STRATEGI PENGEMBANGAN USAHA KERUPUK MIRASA CIAMIS. Sarjana thesis, Universitas Siliwangi.

Hilalludin, Teja (2019) PENGARUH PERHATIAN ORANG TUA TERHADAP KEDISIPLINAN BELAJAR PESERTA DIDIK DAN DAMPAKNYA TERHADAP HASIL BELAJAR (Survey pada Peserta didik Kelas XI di SMA Negeri 1 Manonjaya). Sarjana thesis, Universitas Siliwangi.

Husni Mubarok, Roni (2019) ANALISIS PERANAN UPT PASAR DALAM PENGAWASAN PERDAGANGAN DI PASAR CIAWI KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

I

INTAN FITRIYANI, DEDE (2018) PENERAPAN MODEL PEMBELAJARAN KOOPERATIF TIPE GROUP INVESTIGATION (GI) TERHADAP HASIL BELAJAR PESERTA DIDIK (Studi Quasi Eksperimen pada Mata Pelajaran Ekonomi Kelas X IPS SMA NEGERI 8 Tasikmalaya Tahun Ajaran 2017/2018). Sarjana thesis, Universitas Siliwangi.

INTAN PERTIWI, DEWI (2019) PENGARUH DESAIN BANGUNAN, TATA LETAK FASILITAS DAN LOKASI TERHADAP DAYA SAING OPERASI (Survei Pada Customer Tungku Caffe & Resto Banjar). Sarjana thesis, UNIVERSITAS SILIWANGI.

IZZAH, FATIMAH AQIDATUL (2020) PELAKSANAAN SERVICE EXCELLENT OLEH CUSTOMER SERVICE DALAM UPAYA MENINGKATKAN PELAYANAN TERHADAP NASABAH PADA PT. BANK NEGARA INDONESIA (Persero) Tbk. KANTOR CABANG PEMBANTU (KCP) CIKURUBUK KOTA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Insyanul Taufik, Hilmi (2019) ANALISIS EFEKTIVITAS PROGRAM PENGEMBANGAN USAHA OLAHAN MAKANAN DAN MINUMAN DI MITRA USAHA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

J

Joni, Joni and Rafiqi, Yosep and Marlina, Lina (2016) Analisis Perilaku Konsumen Terhadap Keputusan Menjadi Nasabah Dalam Memilih Pembiayaan Murabahah di BMT al-Hidayah Kawalu Tasikmalaya. JURNAL EKONOMI SYARIAH, 1 (1). pp. 75-86. ISSN 2548-5032

K

KHIZBULLAH, KHIZBULLAH (2019) PENGARUH PRODUKSI, HARGA INTERNASIONAL, INFLASI DAN NILAI TUKAR TERHADAP NILAI EKSPOR KAKAO SERTA DAMPAKNYA TERHADAP VALUE ADDED SEKTOR PERKEBUNAN DI INDONESIA TAHUN 2002-2017. Sarjana thesis, Universitas Siliwangi.

KHOLQILLAH, FIKRI (2020) PROSEDUR PEMBERIAN KREDIT MODAL KERJA KONSTRUKSI PADA PT. BANK PEMBANGUNAN DAERAH JAWA BARAT DAN BANTEN, Tbk. KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

KISWANTO, SINGGIH (2019) ANALISIS PENDAPATAN ASLI DAERAH SEKTOR PARIWISATA DI KABUPATEN PANGANDARAN. Sarjana thesis, Universitas Siliwangi.

KOESDINAR, FARIED (2019) PENGARUH CITRA TOKO DAN LOKASI TERHADAP KEPUTUSAN PEMBELIAN (Survey Pada Konsumen Toko Onderdil Laksana Motor Singaparna). Sarjana thesis, Universitas Siliwangi.

KURNIA, LAWREND (2019) PENGARUH MODAL DAN TENAGA KERJA TERHADAP PRODUKSI BATIK DI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

KURNIAWAN, HADI (2019) PENGARUH EFIKASI DIRI DAN LOCUS OF CONTROL TERHADAP MINAT MENJADI GURU EKONOMI (Survey Pada Mahasiswa Jurusan Pendidikan Ekonomi angkatan2015/2016 Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

Kamarullah, Yusrin (2019) PENGARUH MODAL KERJA DAN AKTIVA TETAP TERHADAP PROFITABILITAS (Survey pada Perusahaan Food and Beverage yang terdaftar di Bursa Efek Indonesia periode 2012 - 2017). Sarjana thesis, Universitas Siliwangi.

Kamelia, Kamelia (2020) PENGARUH DANA PIHAK KETIGA, RASIO KECUKUPAN MODAL DAN PEMBIAYAAN BERMASALAH TERHADAP PEMBIAYAAN YANG DISALURKAN DI BANK SYARIAH MANDIRI PERIODE 2008-2018. Sarjana thesis, Universitas Siliwangi.

Kartawan, Kartawan and Marlina, Lina and Susanto, Agus (2018) Manajemen Sumberdaya Insani. In: Manajemen Sumber Daya Insani. LPPM Universitas Siliwangi, Tasikmalaya. ISBN 978-979-17561-2-9

Khotimah, Devi (2019) PENGARUH FAKTOR PSIKOLOGI DAN SOSIAL TERHADAP KEPUTUSAN MENJADI ANGGOTA DI KSPPS BMT AL-ITTIHAD TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Kurniasih, Euis (2018) Perbandingan Penerapan Model Discovery Learning dan Problem Based Learning Dalam Meningkatkan Kemampuan Berpikir Kritis Siswa (Studi Quasi Eksperimen Pada Mata Pelajaran IPS SMP Negeri 12 Tasikmalaya Tahun Pelajaran 92017/2018). Sarjana thesis, Universitas Siliwangi.

Kusmayadi, Dedi and Badruzaman, Jajang (2017) Efficiency and Profitability of Islamic Banks in Indonesia. Hasil Uji Kemiripan, 23 (9). pp. 1-6. ISSN 8807-881

Kusmayadi, Dedi and Firmansyah, Irman and Badruzaman, Jajang (2017) THE IMPACT OF MACROECONOMIC ON NONPERFORMING LOAN: COMPARISON STUDY AT CONVENTIONAL AND ISLAMIC BANKING. Hasil Reviewer, 11 (2). pp. 193-216. ISSN P-ISSN: 1979-0724 E-ISSN: 2502-3993

Kusmayadi, Dedi and Rudiana, Dedi and Badruzaman, Jajang (2015) GOOD CORPORATE GOVERNANCE. Hasil Reviewer. pp. 1-158. ISSN 978 602 71896 1 4

Kusmayadi, Dedi and Rudiana, Dedi and Badruzaman, Jajang (2015) PEMODELAN TATAKELOLA SEKOLAH YANG BAIK PSCA RINTISAN SEKOLAH BERTARAF INTERNASIONAL (RSBI) DI KOTA TASIKMALAYA. Hasil Reviewer Proceeding Nasional. pp. 1-22. ISSN 978-602-1004-12-8

L

LIESTIANI, RANI (2019) PENGARUH PRESTISE PROFESI GURU DAN DUKUNGAN ORANG TUA TERHADAP MINAT MENJADI GURU. Sarjana thesis, Universitas Siliwangi.

LUTFIYANTI, NILA (2019) PENGARUH KOMPETENSI PEDAGOGIK GURU DAN DISIPLIN KERJA GURU TERHADAP MINAT BELAJAR SISWA (Penelitian Survey terhadap Siswa pada Mata Pelajaran Ekonomi Kelas XI IPS SMA/MA Se-Wilayah Kecamatan Singaparna Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

Latuperissa, Marlince (2019) PENGARUH INTELEGENSI DAN BAKAT SISWA TERHADAP HASIL BELAJAR SISWA DI SMK NEGERI 1 KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Lavia, Hani (2019) ANALISIS IMPLEMENTASI KARAKTERISTIK SYARI’AH MARKETING PADA PEMASAR PT BANK BJB SYARI’AH KCP. CIKURUBUK TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Lesmana Sari, Elis (2019) PENERAPAN MODEL PEMBELAJARAN AUDITORY, INTELLECTUALLY, REPETITION (AIR) BERBANTUKAN MEDIA VIDEO TERHADAP PEMAHAMAN KONSEP PESERTA DIDIK PADA MATA PELAJARAN EKONOMI KELAS X IPS SMA NEGERI 1 JATIWARAS. Sarjana thesis, Universitas Siliwangi.

Loviana, Lena (2019) PENGARUH PEMBERIAN REWARD DAN PUNISHMENT TERHADAP SIKAP SOSIAL (Survey Pada Peserta DidikKelasXI SMA Negeri 3 Kota Tasikmalaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

M

MARDHIANA, CANDRA (2019) PENGARUH INOVASI, DESAIN PRODUK DAN DESAIN PROSES TERHADAP KUALITAS PRODUK PADA PERUSAHAAN CV. KS TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

MARTYANINGSIH, DWI (2019) PENERAPAN MODEL PEMBELAJARAN PROBLEM BASED LEARNING BERBANTUKAN MEDIA VIDEO DALAM MENINGKATKAN KEMAMPUAN BERPIKIR KREATIF DAN BERPIKIR KRITIS SISWA. Sarjana thesis, Universitas Siliwangi.

MARYANA, ADITTYA (2020) PELAKSANAAN SERVICE EXCELLENT OLEH CUSTOMER SERVICE PADA PT. BANK TABUNGAN NEGARA (PERSERO), Tbk. KANTOR KAS PADAYUNGAN TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

MARYANA, NINDYA (2019) PENGARUH KUALITAS LAYANAN TOKO ONLINE DAN MOTIF PEMBELIAN TERHADAP KEPUTUSAN PEMBELIAN MAHASISWA JURUSAN PENDIDIKAN EKONOMI (Survei Pada Mahasiswa Universitas Siliwangi Jurusan Pendidikan Ekonomi Angkatan 2017/2018). Sarjana thesis, Universitas Siliwangi.

MAUDI, DEVI (2020) MEKANI SMELAYANANBTN PAYROLL DIPT.BANKTABUNGANNEGARA ( PERSERO) , Tbk.KANTORKASPADAYUNGANTASI KMALAYA. Diploma thesis, Universitas Siliwangi.

MAULIDINA, TYAS (2019) DETERMINAN EKSPOR TEH INDONESIA TAHUN 2002-2017. Sarjana thesis, Universitas Siliwangi.

MAYA, ROSMAYANTI (2020) PENGARUH FINANCIAL LEVERAGE, PROFITABILITAS, DAN KESEMPATAN INVESTASI TERHADAP DIVIDEND PAYOUT RATIO (Penelitian pada PT. Kimia Farma Tbk). Sarjana thesis, Universitas Siliwangi.

MEGA MARSELINA, BELLA (2021) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI EKSPOR CPO (CRUDE PALM OIL) KE TIONGKOK SERTA PENGARUHNYA TERHADAP CADANGAN DEVISA (PERIODE TAHUN 2005-2019). Sarjana thesis, Universitas Siliwangi.

MEIDIANTI SUNARYA, TANTI (2019) PENERAPAN MODEL PEMBELAJARAN INKUIRI TERBIMBING UNTUK MENINGKATKAN PEMAHAMAN KONSEP SISWA PADA MATA PELAJARAN EKONOMI (Studi Kuasi Eksperimen terhadap Siswa Kelas X IPS SMA Negeri 8 Tasikmalaya Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

MEILANI AHSANA PRAIKA, AYU (2019) PENERAPAN MODEL PEMBELAJARAN DISCOVERY LEARNING DALAM MENINGKATKAN KEMAMPUAN BERPIKIR ANALITIS SISWA PADA MATA PELAJARAN EKONOMI (Studi Quasi Eksperimen Kelas XI IPS MAN Kota Banjar Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

MEYLANI MEGAWATI, RANNY (2019) PENERAPAN MODEL PROBLEM SOLVING BERBANTUKAN METODE DEBAT DALAM MENINGKATKAN KEMAMPUAN BERPIKIR KRITIS PADA SISWA SMA NEGERI 7 KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

MUHAMAD RIYADI, TAUFIK (2019) ANALISIS STRUKTUR EKONOMI KABUPATEN CIAMIS TAHUN 2013-2017. Sarjana thesis, Universitas Siliwangi.

MUHAMMAD HAKIKI, IKBAL (2019) ANALISIS POLA KONSUMSI SEBELUM DAN SESUDAH MENJADI DRIVER GO-JEK (Survey di Kecamatan Tawang Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

MUHAMMAD WIJAKSONO, DHIMAS (2019) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI NILAI EKSPOR KAYU MANIS INDONESIA PERIODE 2000-2017. Sarjana thesis, Universitas Siliwangi.

MUHARAM, FAHMI (2019) PENGARUH PENDIDIKAN KEWIRAUSAHAAN DAN LINGKUNGAN KELUARGA TERHADAP SIKAP KEWIRAUSAHAAN SISWA KELAS XI SMK NEGERI 2 KOTA TASIKMALAYA (Survey pada Siswa Kelas XI SMK Negeri 2 Kota Tasikmalaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

MULYANINGSIH, SEVTY (2019) PENGARUH CARA BELAJAR DAN IKLIM SEKOLAH TERHADAP MOTIVASI BELAJAR SISWA (Survei pada Siswa SMA Muhammadiyah Kota Tasikmalaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

MUSTIKA, AI (2020) PROSEDUR PEMBUKAAN REKENING TABUNGAN iB HIJRAH DENGAN AKAD WADI’AH YAD DHAMANAH PADA BANK MUAMALAT INDONESIA (BMI) KCP SINGAPARNA. Diploma thesis, Universitas Siliwangi.

Maliha, Hasna and Marlina, Lina (2019) Mengapa Bank Syariah Relatif Lebih Tahan Krisis? Aplikasi Logistic Regression untuk Sistem Deteksi Dini Krisis Finansial di Indonesia. JURNAL EKONOMI SYARIAH, 1 (1). pp. 34-55. ISSN 2548-5032

Malikul Mulki, Riki (2019) ANALISIS EFISIENSI FAKTOR PRODUKSI PADA USAHA TANI KENTANG DI KELOMPOK TANI RAKSAWANA AGRO CIKANDANG GARUT. Sarjana thesis, Universitas Siliwangi.

Mariah, Siti (2019) PENERAPAN MEDIA PEMBELAJARAN BERBASIS MACROMEDIA FLASH BERBENTUK ANIMASI UNTUK MENINGKATKAN HASIL BELAJAR PESERTA DIDIK PADA MATA PELAJARAN EKONOMI DI MAN 1 KOTA TASIKMALAYA (Studi Quasi Eksperimen pada Mata Pelajaran Ekonomi Kelas X IPS MAN 1 Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Marlina, Lina (2015) Faktor-Faktor yang Mempengaruhi Keputusan Menjadi Nasabah Bank Syariah. Jurnal Magister Manajemen Pascasarjana Unsll, 1 (1). pp. 32-45. ISSN 2085-7055

Marlina, Lina (2019) The Influence of Economic Growth, Job Opportunity and People Prosperity on Islamic Banking Growth in Six Provinces in Java Island. INTERNATIONAL JOURNAL OF NUSANTARA ISLAM, 7 (2). pp. 190-202. ISSN 2252-5904

Marlina, Lina TWENTY YEARS OF ISL Y YEARS OF ISLAMIC BANKING IN INDONESI AMIC BANKING IN INDONESIA A BIBLIOSHINY APPLICATION. Hasil Reviewer.

Marlina, Lina and Iskandar, Jajang (2019) Pengaruh Bagi Hasil dan Pendapatan Perkapita terhadap Peningkatan Dana Pihak Ketiga. JURNAL EKONOMI SYARIAH, 4 (1). pp. 1-17. ISSN 2548-5032

Marlina, Lina and Rusydiana, Aam Slamet and Otoillah, Muhammad Anton (2018) Malmquist Index To Measure the Efficiency and Productivity of Indonesia Islamic Banks. 2nd ICIFEB 2018 International Conference on Islamic Finance Economics and Business UIN Syarif Hidayatullah Jakarta.

Marlina, Lina and Sudana, Sudana (2020) Does The Population Number, The Economic Growth, and The Inflation Influence The Growth of Islamic Bank in Indonesia? Journal of Islamic Monetary Economics and Finance, 7 (5). pp. 723-729. ISSN 2394-5125

Marlina, Lina and Zahra Nasution, Fatimah (2016) Faktor-Faktor yang Mempengaruhi Keputusan Mahasiswa Memilih Program Studi Ekonomi Syariah Pada Fakultas Agama Islam Universitas Siliwangi. JURNAL EKONOMI SYARIAH, 1 (1). pp. 60-74. ISSN 2548-5032

Marlina, Lina and Zulfikar Rahmat, Biki (2018) Peran Lembaga Keuangan Syariah dalam Mengimplemen-tasikan Keuangan Inklusif bagi Pelaku UMKM Tasikmalaya. JURNAL ECODEMICA, 1 (2). pp. 125-135. ISSN 2355-0295

Masitoh, Imas (2020) PENGARUH INOVASI PRODUK DAN HARGA JUAL TERHADAP MINAT BELI DI PERUSAHAAN KELOM GEULIS KARIMA KEY TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Maulana, Azis (2019) ANALISIS KEPUTUSAN PEMBELIAN BERDASARKAN LABELISASI HALAL DI DEPOT JAMU HERBAL CIAWI TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Maya Mutiara, Radela (2018) PENERAPAN MODEL PEMBELAJARAN INKUIRI DALAM MENINGKATKAN KEMAMPUAN BERPIKIR KRITIS (Studi Quasi Eksperimen pada kelas XI IPS SMA Negeri 6 Tasikmalaya ). Sarjana thesis, Universitas Siliwangi.

Meiluwati, Andini (2020) PENGARUH DANA PIHAK KETIGA, PEMBIAYAAN BAGI HASIL DAN CAPITAL ADEQUACY RATIO TERHADAP RETURN ON ASSET PADA BANK MUAMALAT INDONESIA PERIODE 2008-2018. Sarjana thesis, Universitas Siliwangi.

Meiluwati, Andini (2020) PENGARUH DANA PIHAK KETIGA, PEMBIAYAAN BAGI HASIL DAN CAPITAL ADEQUACY RATIO TERHADAP RETURN ON ASSET PADA BANK MUAMALAT INDONESIA PERIODE 2008-2018. Sarjana thesis, Universitas Siliwangi.

Milu, Tri Cahyani (2019) ANALISIS FAKTOR-FAKTOR INTERNAL DALAM PENGEMBANGAN USAHA BUBUR AYAM KALEKTORAN H. ZENAL KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Mochamad Thopik, Rizky (2018) ANALISIS IMPLEMENTASI AGUNAN PADA AKAD MUDHARABAH DAN MURABAHAH DI BMT AL-HIDAYAH KAWALU TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Muhamad, Mulyana (2020) ANALISIS KESEHATAN KOPERASI SIMPAN PINJAM SIMPENAN PAMEUNGKEUT BANDA (KSP SPB) TASIKMALAYA TAHUN 2017-2019. Diploma thesis, Universitas Siliwangi.

Muhamad Nur, Parid (2020) MEKANISME KLIRING DI PT. BANK NEGARA INDONESIA (PERSERO) Tbk. KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Muhammad Lathif, Rizqi (2021) ANALISIS PENDAPATAN DAN R/C-RATIO PADA USAHA TELUR AYAM LOKAL DAN TELUR AYAM DARI JAWA TENGAH (Studi kasus pada pedagang Telur Ayam Lokal dan Telur Ayam dari Jawa Tengah di Pasar Cikurubuk Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Mulyadi, Sandi (2019) ANALISIS IMPLEMENTASI FUNGSI PENGORGANISASIAN DALAM PENGELOLAAN SUMBER DAYA INSANI DI KSPPS MITRA INSAN MANDIRI. Sarjana thesis, Universitas Siliwangi.

Mulyana, Deden ANALYSIS OF SHARES AND LIQUIDITY EFFECT SHARE PRICE ON THE COMPANY THAT IS ON THE STOCK EXCHANGE INDEX IN INDONESIA LQ45. Hasil Reviewer.

Mulyana, Deden Building Costumer Trust Through Experience On Healthcare Industry.

Mulyana, Deden Building the Brandldentiy thrugh Brand Differentiation Based Valueof Culture and Locally-global Product Principles(Case on the CityArt). Hasil Uji Kemiripan.

Mulyana, Deden Mellenial Urban Generations. Does Become 'A Current Generation' Shift Their Attention To Financial Literacy. Hasil Uji Kemiripan.

Mulyana, Deden Pengaruh Servicescape dan Citra Merek Terhadap Keputusan Pembelian (Studi pada Klinik Bersalin 'Bunga Mawarni' Kota Banjar). Hasil Reviewer.

Mulyana, Deden THE ROLE OF VALUE CO-CREATION BASED ON ENGAGEMENT TO DEVELOP BRAND ADVANTAGE. Hasil Reviewer.

Mulyana, Deden and Hastuti Lestari Komarlina, Dwi and Rustandi, Iyus (2013) Pengaruh Kualitas Pelayanan terhadap Kepuasan Pemakai Kios Pasar di UPTD Koperasi dan Pasar Guntur Ciawitali Kabupaten Garut. JURNAL ILMU EKONOMI. ISSN 2301-8828

Mulyana, Deden and Nurichani, Nila (2018) Factors Influencing Capital Expenditure. The 1st Inter-University Forum for Strengthening Academic Competency. pp. 35-43. ISSN 978-623-7111-21-4

Mulyana, Deden and Rudiana, Dedi and Rahmat Taufiq, Adhitya (2019) The Role Value Cocreation Based on Engagement to Develope Brand Advantage. Polish Journal of Management Studies, 20 (1). pp. 305-317. ISSN 2081-7452

N

NABILA APRILIANI, NINDI (2019) PENGARUH KONDISI PESERTA DIDIK DAN SARANA PRASARANA BELAJAR DI SEKOLAH TERHADAP PRESTASI BELAJAR PADA MATA PELAJARAN EKONOMI (Survei Pada Peserta Didik Kelas X IPS SMA Islam Cipasung Kabupaten Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

NADYA, ASTRY (2019) PENGARUH PENGEMBANGAN PRODUK DAN PEMELIHARAAN MESIN TERHADAP KUALITAS PRODUK (Survey pada Perusahaan Pesack Clothes Tasikmalaya). Sarjana thesis, UNIVERSITAS SILIWANGI.

NIRMAYANI, . (2019) PENERAPAN MODEL PEMBELAJARAN INKUIRI TERBIMBING DALAM MENINGKATKAN KEMAMPUAN BERPIKIR KREATIF SISWA PADA MATA PELAJARAN EKONOMI (Studi Quasi Eksperimen pada Kelas XI IPS SMAN 1 Jatiwaras Kabupaten Tasikmalaya Tahun Pelajaran 2019/2020). Sarjana thesis, Universitas Siliwangi.

NOEGRAHA, YANUAR YOAN PENGARUH KEPEMIMPINAN, IKLIM ORGANISASI DAN LINGKUNGAN KERJA TERHADAP KEPUASAN KERJA (Survei pada Pegawai Dinas di Lingkungan Pemerintah Kota Tasikmalaya). Sarjana thesis, UNSPECIFIED.

NUGRAINI, KANIA (2019) ANALISIS PENGARUH TENAGA KERJA, NILAI EKSPOR DAN JUMLAH PERUSAHAAN TERHADAP PRODUK DOMESTIK BRUTO (PDB) SUBSEKTOR INDUSTRI KREATIF DI INDONESIA TAHUN 2011-2016. Sarjana thesis, Universitas Siliwangi.

NUR FAUZIAH, ANITA (2017) PENGARUH DESAIN DAN KUALITAS PRODUK TERHADAP DAYA SAING (Studi Kasus Pada Konsumen Perusahaan Batik Deden Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

NUR RAMDHANI SUPRIADI, HADI (2019) PENGARUH MODAL TETAP, TENAGA KERJA DAN BAHAN BAKU TERHADAP HASIL PRODUKSI (Studi Kasus pada Industri Tikar Mendong di Kecamatan Purbaratu Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

NURHAMIDAH, SANTI (2019) PENERAPAN MODEL PROBING PROMPTING LEARNING DENGAN BANTUAN MEDIA POSTER DALAM MENINGKATKAN KEMAMPUAN BERPIKIR KRITIS PESERTA DIDIK (Studi Quasi Eksperimen Mata Pelajaran Ekonomi Kelas XI SMA Negeri 2 Tasikmalaya Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

NURIHSAN, AZIZ (2019) ANALISIS PREFERENSI PENGGUNAAN JASA FOTO PREWEDDING DI KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

NURJANAH, DEWI (2019) ANALISIS TENAGA KERJA DI INDONESIA TAHUN 2010 (DENGAN MENGGUNAKAN TABEL INPUT-OUTPUT). Sarjana thesis, Universitas Siliwangi.

Nafisa, Nisa (2019) PENGARUH MOTIVASI KERJA DAN KOORDINASI PADA UPZ TERHADAP KINERJA BAZNAS KABUPATEN CIAMIS. Sarjana thesis, Universitas Siliwangi.

Nasir, Lutpi (2019) FAKTOR-FAKTOR YANG MEMPERNGARUHI PERMINTAAN KOPI (STUDY KASUS DI KEDAI KOPI FULLHOPPER TASIKMALAYA). Sarjana thesis, Universitas Siliwangi.

Noor Aini, Regita and Badruzaman, Jajang and Hermansyah, Iwan (2020) The Influence of Earnings Response Coefficient (ERC) and Dividend Payout Ratio (DPR) on Stock Price. Hasil Revierwer, 3 (4). pp. 77-84. ISSN 2523-9414 (Print); 2523-6563 (Online)

Nur, Rohmah Rohimah (2020) STRATEGI RESTRUKTURISASI DALAM PENYELAMATAN KREDIT AGUNAN RUMAH (KAR) BERMASALAH PADA PT BANK TABUNGAN NEGARA (PERSERO) Tbk CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Nur Fadilah, Mila (2019) PENGARUH STATUS SOSIAL EKONOMI ORANG TUA TERHADAP SELF-ESTEEM DAN IMPLIKASINYA PADA PRESTASI BELAJAR SISWA SMA NEGERI 10 KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Nur Insani, Anisa (2020) TINJAUAN REALISASI KREDIT USAHA RAKYAT (KUR) PADA NASABAH USAHA MIKRO KECIL MENENGAH (UMKM) PT. BANK NEGARA INDONESIA (PERSERO) Tbk KANTOR CABANG PEMBANTU CIAMIS. Diploma thesis, Universitas Siliwangi.

Nurdiansyah, Didin (2020) MEKANISME PENGGUNAAN TAPCASH DALAM TRANSAKSI PEMBAYARAN ELEKTRONIK PADA PT. BANK NEGARA INDONESIA (PERSERO), Tbk. KANTOR CABANG PEMBANTU CIAWI TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Nurfalah, Sarah (2019) PENGARUH PEMBERIAN REWARD DAN PUNISHMENT TERHADAP MINAT BELAJAR PESERTA DIDIK PADA MATA PELAJARAN EKONOMI KELAS X IPS SMA NEGERI 7 TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Nurlaela, Ela (2020) PROSEDUR PELAKSANAAN KREDIT USAHA MIKRO (KUM) PADA PT. BANK “X” (PERSERO) Tbk. KANTOR CABANG TASIKMALAYA SUTISNA. Diploma thesis, Universitas Siliwangi.

Nurlita, Risa (2019) PENGARUH PEMBERIAN REWARD AND PUNISHMENT SERTA PERSEPSI SISWA TENTANG KOMPETENSI PEDAGOGIK GURU TERHADAP PRESTASI BELAJAR SISWA PADA MATA PELAJARAN EKONOMI (Survey Pada Siswa IPS Kelas X dan XI di Madrasah Aliyah AL-Amin Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Nurnawati, Rani (2018) ANALISIS PENGEMBANGAN USAHA KELOMPOK SIMPAN PINJAM PEREMPUAN (SPP) DI UNIT PENGELOLA KEGIATAN (UPK) KECAMATAN JATIWARAS. Sarjana thesis, Universitas Siliwangi.

Nurul Hidayanti, Maula (2019) PENGARUH KUALITAS PELATIHAN DAN MOTIVASI KERJA TERHADAP KOMPETENSI KARYAWAN DI KSPPS TUNAS ARTHA MANDIRI KANTOR CABANG TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Nurul Khomisah, Enung (2019) PENGARUH PROMOSI, LOKASI, FASILITAS ATM CENTRE DAN LITERASI KEUANGAN TERHADAP KEPUTUSAN NASABAH MENABUNG DI BANK SYARIAH (Studi pada Nasabah Bank Syariah Mandiri Kantor Kas Rancah, Kabupaten Ciamis). Sarjana thesis, Universitas Siliwangi.

Nur’aini, Nunung (2019) ANALISIS STRATEGI FUNDRAISING DALAM MENARIK MINAT MUZAKKI DI LEMBAGA AMIL ZAKAT DOMPET DHUAFA JAWA BARAT. Sarjana thesis, Universitas Siliwangi.

P

PAHIRA PANI, HARNI (2019) PENERAPAN MODEL COLLABORATIVE LEARNING MURDER ( MOOD, UNDERSTAND, RECALL, DIGEST, EXPAND, AND REVIEW ) TERHADAP PENINGKATAN PEMAHAMAN KONSEP PESERTA DIDIK (Studi Kuasi Eksperimen Pelajaran Ekonomi Kelas XI IPS SMA Muhammadiyah 1 Tasikmalaya Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

PAMELA, DINDA RIZKA (2020) ANALISIS KETERKAITAN ANTAR SEKTOR, PENGGANDA OUTPUT DAN PENGGANDA PENDAPATAN TERHADAP SEKTOR-SEKTOR UNGGULAN (Data Empirik Input-Output Provinsi Jawa Barat Tahun 2015). Sarjana thesis, Universitas Siliwangi.

PEPI RAHMANI, HANI (2018) PENGARUH KOMPETENSI PROFESIONALISME DAN KOMPETENSI KEPRIBADIAN GURU TERHADAP HASIL BELAJAR SISWA PADA MATA PELAJARAN EKONOMI (Survey Pada Siswa SMA Di Kecamatan Cikatomas Kabupaten Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

PERMADI, NUGRAHA (2019) PENGARUH PRODUKSI PERIKANAN, PENANAMAN MODAL DALAM NEGERI, PENANAMAN MODAL ASING DAN TENAGA KERJA TERHADAP PRODUK DOMESTIK BRUTO SEKTOR PERIKANAN DI INDONESIA TAHUN 2000-2017. Sarjana thesis, Universitas Siliwangi.

PERMATASARI, NURI (2019) PENGARUH KEMANDIRIAN BELAJAR DAN LINGKUNGAN TEMAN SEBAYA TERHADAP HASIL BELAJAR (Penelitian Survey Terhadap Peserta Didik Kelas X dan XI IPS di SMAN 6 Tasikmalaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

PRANA PRISAPAN, ADI (2018) Pengaruh Persepsi Kompetensi Profesional Guru Terhadap Prestasi Belajar Siswa Pada Bidang Studi Kewirausahaan. Sarjana thesis, Universitas Siliwangi.

PRATAMA HARI PUTRA, FAUZIA (2019) PENGARUH PENERAPAN STANDAR OPERASIONAL PROSEDUR DAN PENGENDALIAN KUALITAS TERHADAP KEUNGGULAN BERSAING (Survey pada Distro yang ada di Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

PRATIWI, PRATIWI SITI PATIMAH (2020) PENGARUH INTEREST BASED INCOME DAN FEE BASED INCOME TERHADAP PROFITABILITAS (Sensus Pada Perusahaan Perbankan Konvensional yang terdaftar di Bursa Efek Indonesia). Sarjana thesis, Universitas Siliwangi.

Padilah, Cepi Patwa (2018) PENGARUH STRES KERJA TERHADAP KINERJA KARYAWAN (Suatu Penelitian Pada Karyawan Pembayaran dan Pelayanan Administrasi Bank Indonesia Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Pebriyani, Riyas (2020) PROSEDUR PEMBUKAAN DEPOSITO MANTAP PADA PT. BANK MANDIRI TASPEN KANTOR KAS CIAMIS. Diploma thesis, Universitas Siliwangi.

Pirmansah, M. Haris (2019) PENGARUH FASILITAS BELAJAR DAN MOTIVASI BELAJAR TERHADAP PRESTASI BELAJAR SISWA (Survei pada Siswa Kelas X IPS SMAN 1 Ciawi Kabupaten Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Prajwalita Cahyani, Regina (2019) PENGARUH PENGALAMAN BERORGANISASI INTERN TERHADAP PENGEMBANGAN SOFT SKILL (Survei pada Mahasiswa Jurusan Pendidikan Ekonomi Universitas Siliwangi Angkatan 2016 dan 2017). Sarjana thesis, Universitas Siliwangi.

Pramodya, Sinta (2019) PENGARUH TINGKAT SUKU BUNGA DAN VOLUME PENJUALAN SAHAM TERHADAP HARGA SAHAM (Penelitian pada PT. XL Axiata Tbk). Sarjana thesis, Universitas Siliwangi.

Pratama Oktaviana Rahman, Satiya (2018) PENGARUH LINGKUNGAN KERJA DAN TATA LETAK FASILITAS PABRIK TERHADAP PRODUKTIVITAS KARYAWAN (Survei pada Karyawan Bagian Produksi di CV. Bastoh Tasikmalaya). Sarjana thesis, UNIVERSITAS SILIWANGI.

Pratiwi Haryono, Putriani (2019) PENERAPAN MODEL PEMBELAJARAN PROJECT BASED LEARNING UNTUK MENINGKATKAN KEMAMPUAN BERPIKIR KREATIF PESERTA DIDIK (Studi Kuasi Eksperimen Pada Mata Pelajaran Prakarya danKewirausahaanKelas XI IPA SMA Negeri 1 Ciawi Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Purnamasari, Restu (2019) PENERAPAN MODEL PEMBELAJARAN KOOPERATIF TIPE MAKE A MATCH DALAM MENINGKATKAN HASIL BELAJAR SISWA (Studi Quasi Eksperimen Pada Mata Pelajaran Ekonomi Kelas X IPS MAS Cilendek Kota Tasikmalaya Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

Puspita, Nafa (2019) PENERAPAN MODEL PEMBELAJARAN ROLE PLAYING DENGAN MENGGUNAKAN ALAT PERAGA UNTUK MENINGKATKAN KEMAMPUAN PEMAHAMAN SISWA (Studi Eksperimen Pada Mata Pelajaran Ekonomi Kelas X IIS MAN 3 Kota Tasikmalaya Tahun Pelajaran 2018/ 2019). Sarjana thesis, Universitas Siliwangi.

Putri Setiawan, Regita (2020) PENERAPAN STRATEGI PEMASARAN SIMPANAN DEPOSITO BERJANGKA RUPIAH PADA PT. BANK NEGARA INDONESIA (PERSERO) Tbk. KANTOR CABANG PEMBANTU CIAMIS. Diploma thesis, Universitas Siliwangi.

R

RAHAYU, FAJAR (2019) ANALISIS PENGARUH JUMLAH EMITEN, KURS, SUKU BUNGA DEPOSITO DAN LAJU INFLASI TERHADAP INDEKS HARGA SAHAM SEKTOR KEUANGAN DI BURSA EFEK INDONESIA TAHUN 2003-2018. Sarjana thesis, Universitas Siliwangi.

RAHAYU NINGRUM, ASRI (2019) KOORDINASI, EVALUASI KERJA DAN SPIRITUALITAS DI TEMPAT KERJA SEBAGAI FAKTOR PENENTU TERHADAP KINERJA PEGAWAI (Survey Pada Pegawai Puskesmas Di Wilayah Kota Tasikmalaya). Pascasarjana thesis, Universitas Siliwangi.

RAHMA FADLILAH, VILIA (2019) ANALISIS PERMINTAAN BAWANG MERAH (Studi Kasus di Kecamatan Cibeurueum Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

RAHMAN, BOBBY (2020) PROSEDUR PENCAIRAN KLAIM ASURANSI KECELAKAAN ANGKUTAN UMUM PADA PT. JASA RAHARJA (PERSERO) KANTOR PERWAKILAN TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

RAHMATILAH, RAHMATILAH (2019) PENGARUH STATUS SOSIAL EKONOMI ORANG TUA DAN PRESTASI BELAJAR MAHASISWA TERHADAP MINAT MENJADI GURU EKONOMI (Survey Pada Mahasiswa Jurusan Pendidikan Ekonomi Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

RAHMATILLAH, AI (2019) PENGARUH KEMISKINAN, PERTUMBUHAN EKONOMI, BELANJA MODAL DAN PERTUMBUHAN PENDUDUK TERHADAP INDEKS PEMBANGUNAN MANUSIA DI JAWA BARAT TAHUN 2008-2017. Sarjana thesis, Universitas Siliwangi.

RAHMAWATI, RAHMAWATI (2019) ANALISIS PENERAPAN AKUNTANSI SYARIAH BERDASARKAN PSAK NOMOR. 102 PADA PEMBIAYAAN MURABAHAH DI BMT AL-ITTIHAD CIKURUBUK TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

RAHMAWATI, RISKA (2019) PENGARUH GAJI DAN TUNJANGAN TERHADAP KINERJA KARYAWAN (Study Kasus Pada Karyawan Bagian Penjualan di PT. Rizki Teknik Utama). Sarjana thesis, Universitas Siliwangi.

RAMADAN, PANI (2016) PENGARUH BIAYA PENGEMBANGAN PRODUK TERHADAP PENINGAKATAN VOLUME PENJUALAN PADA HOME INDUSTRI KELOM GEULIS SHENY KOTA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

RAMDAN AZHARI, ARIF (2019) DETERMINAN PERTUMBUHAN PENYERAPAN TENAGA KERJA PADA SEKTOR INDUSTRI MANUFAKTUR DI JAWA BARAT TAHUN 2005-2018. Sarjana thesis, Universitas Siliwangi.

RAMDANI, ARI (2019) ANALISIS LIMA NEGARA TUJUAN EKSPOR KARET INDONESIA TAHUN 2013-2017. Sarjana thesis, Universitas Siliwangi.

RATNASARI WIKARYO, FRANSISKA (2016) ANALISIS PERBANDINGAN ABNORMAL RETURN DAN TRADING VOLUME ACTIVITY SEBELUM DAN SETELAH PENGUMUMAN RIGHT ISSUE DI BURSA EFEK INDONESIA (Sensus Pada Perusahaan Yang Melakukan Right Issue Tahun 2014). Sarjana thesis, Universitas Siliwangi.

RIFALDI, FILZA (2019) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI PENDAPATAN NELAYAN DI KECAMATAN PANGANDARAN KABUPATEN PANGANDARAN. Sarjana thesis, Universitas Siliwangi.

RINDIYANTI, PUPUT (2019) PENERAPAN MODEL PEMBELAJARAN PROBLEM SOLVING DENGAN BANTUAN MEDIA VISUAL DALAM MENINGKATKAN KEMAMPUAN BERPIKIR KRITIS SISWA (Studi Quasi Eksperimen Pada Mata Pelajaran Ekonomi Kelas XI IPS SMA Negeri 1 Jatiwaras). Sarjana thesis, Universitas Siliwangi.

RISKA SOPIYANTI, FEMMY (2020) ANALISIS KUNJUNGAN WISATAWAN KE PANTAI PANGANDARAN KABUPATEN PANGANDARAN. Sarjana thesis, Universitas Siliwangi.

ROSLINAWATI, . (2019) PENGARUH MODAL, BAHAN BAKU DAN TENAGA KERJA TERHADAP PRODUKSI PAKAIAN BORDIR KOMPUTER DI DESA SUKAMENAK KECAMATAN SUKARAME KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

RYAN, MUHAMMAD RAMADHAN (2019) PENGARUH KUALITAS PELAYANAN DAN FASILITAS BANK TERHADAP KEPUTUSAN MENJADI NASABAH PENABUNG DI PT BANK BJB SYARIAH KANTOR KAS JASA KARTINI TASIKMALAYA. Sarjana thesis, universitas siliwangi.

Rachman, Rusyidi (2019) PENGARUH LITERASI EKONOMI DAN MODERNITAS TERHADAP PERILAKU KONSUMTIF MAHASISWA PENDIDIKAN EKONOMI (Survei Pada Mahasiswa Pendidikan Ekonomi Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

Rahmatullah AR, Decky (2019) ANALISIS PERILAKU PRODUKSI ISLAMI PADA MAKANAN KEMASAN DI INDUSTRI RUMAH TANGGA DESA RAWA KECAMATAN CINGAMBUL KABUPATEN MAJALENGKA. Sarjana thesis, Universitas Siliwangi.

Rahmawati, Pipit (2019) IMPLEMENTASI AKAD MUZARAAH PADA TANAH WAKAF DI DKM BAITURROHIM, DUSUN BOJONGGENTENG, DESA KERTAJAYA, KECAMATAN MANGUNJAYA, KABUPATEN PANGANDARAN. Sarjana thesis, Universitas Siliwangi.

Ramadhan, Fajar (2019) ANALISIS PEMAHAMAN PETANI TENTANG ZAKAT PERTANIAN DI DESA CIAMPANAN KECAMATAN CINEAM KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Ramdaniyati, Rani (2019) PENGARUH E-COMMERCE DAN GAYA HIDUP TERHADAP PERILAKU KONSUMTIF MAHASISWA PENDIDIKAN EKONOMI FAKULTAS KEGURUAN DAN ILMU PENDIDIKAN UNIVERSITAS SILIWANGI. Sarjana thesis, Universitas Siliwangi.

Rani Rohmah, Siti (2019) IMPLEMENTASI PENDAMPINGAN DALAM PEMBERDAYAAN EKONOMI PADA PROGRAM MISYKAT DT PEDULI PRIANGAN TIMUR. Sarjana thesis, Universitas Siliwangi.

Raspika, Raspika (2020) PELAKSANAAN STANDAR OPERASIONAL PROSEDUR DALAM PENGELOLAAN DOKUMEN ARSIP PADA PT. BANK NEGARA INDONESIA (PERSERO) Tbk. KANTOR CABANG PEMBANTU CIKURUBUK KOTA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Ratnasari, Rani (2020) ANALISA LAPORAN KEUANGAN DENGAN MENGGUNAKAN METODE TREND COMMON SIZE PERIODE TAHUN 2017-2019 PADA KOPERASI SIMPAN PINJAM SIMPENAN PAMEUNGKEUT BANDA KOTA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Raudya Tahmid, Reka (2020) STRATEGI PEMASARAN PRODUK TAPENAS DALAM MENINGKATKAN JUMLAH NASABAH PADA PT.BANK NEGARA INDONESIA (PERSERO) TBK KCP CIAWI TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Resa, Resa (2020) MEKANISME PENGAJUAN KARTU KREDIT PADA PT. BANK NEGARA INDONESIA (PERSERO) Tbk. KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Ridwanto, Riki (2019) PENGARUH KUALITAS KEHIDUPAN KERJA DAN KETERLIBATAN KERJA TERHADAP KINERJA KARYAWAN (Penelitian Pada Pegawai Perusahaan Non Manajer Di Kantor Pusat Perusahaan Daerah Air Minum (PDAM) Tirta Sukapura Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Rohman, Abdul (2019) PERBANDINGAN MEDIA PEMBELAJARAN FLASH CARD DAN FLIP CHART MELALUI MODEL PEMBELAJARAN PICTURE AND PICTURE DALAM MENINGKATKAN HASIL BELAJAR SISWA PADA MATA PELAJARAN EKONOMI. Sarjana thesis, Universitas Siliwangi.

Roni, Adam (2019) PERAN DPS DALAM PENGAWASAN PEMBIAYAAN MULTIJASA DI BPRS AL-MADINAH TASIKMALAYA. Sarjana thesis, UNIVERSITAS SILIWANGI.

Rusydiana, Aam Slamet and Firmansyah, Irman and Marlina, Lina (2018) Sentiment Analysis of Microtakaful Industry. INTERNATIONAL JOURNAL OF NUSANTARA ISLAM, 6 (1). pp. 20-34. ISSN 2252-5904

Rusydiana, Aam Slamet and Marlina, Lina (2018) Efficiency, Productivity ans Stability of Islamic Banks in Indonesia. Proceedings 4th SEABC 2018. Sriwijaya Economics, Accounting, and Business Conference Internasional Seminar and Conference, Faculty of Economics, Universitas Sriwijaya Palembang Indonesia. pp. 566-572.

Rusydiana, Aam Slamet and Marlina, Lina (2019) Financial and Social Efficiency on Indonesian Islamic Banks. Journal of Islamic Monetary Economics and Finance, 5 (3). pp. 579-602. ISSN 2460-6146

Rusydiana, Aam Slamet and Marlina, Lina and Rani, Lina Nugraha (2019) Malmquist Productivity Index on Islamic Economics and Finance Research. Journal of Economics and Business Shirkah, 4 (1). pp. 99-131. ISSN 2503-4235

Rusydiana, Aam Slamet and Sudana, Sudana and Marlina, Lina (2019) Manakah Prioritas Sektor Pengembangan Wakaf di Indonesia? JURNAL ECODEMICA, 4 (1). pp. 7-16. ISSN 2355-0295

Rusydiana, Aam Slamet and Tanjung, Hendri and Marlina, Lina (2018) Maslahah Based Measurement on Indonesia Islamic Banks. INTERNATIONAL IURNAL OF ISLAMIC BUSINESS ETHICS, 3 (1). ISSN 978-979-17561-2-9

S

SATILA, SUNIYA (2019) ANALISIS PENERIMAAN PEDAGANG KAKI LIMA CAR FREE DAY DI KABUPATEN GARUT. Sarjana thesis, Universitas Siliwangi.

SELA SINTIA, TIA (2019) PENGARUH KEPEMIMPINAN KEPALA SEKOLAH TERHADAP KINERJA GURU SMA NEGERI SE-KOTA TASIKMALAYA (Survey Terhadap Guru Ekonomi SMA Negeri Se-kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

SEPTI ANGGIA, ANISA (2019) PERANANAN KEMAMPUAN PAJAK DAERAH RETRIBUSI DAERAH DAN LABA BUMD DALAM MENINGKATKAN PENDAPATAN ASLI DAERAH DI PROVINSI JAWA BARAT TAHUN 2004-2017. Sarjana thesis, Universitas Siliwangi.

SEPTIAWAN, DERRY (2019) FAKTOR – FAKTOR YANG MEMPENGARUHI INFLASI DI INDONESIA TAHUN 2008 -2017. Sarjana thesis, Universitas Siliwangi.

SILA, RESA NUR (2020) MEKANISME PELAPORAN SPT 1770 (USAHAWAN ATAU PEKERJA BEBAS) SECARA ELEKTRONIK PADA KANTOR PELAYANAN PAJAK PRATAMA CIAMIS. Diploma thesis, Universitas Siliwangi.

SITI ALIA, DESTRI (2019) ANALISIS KEMISKINAN DITINJAU DARI SUDUT PRODUKTIVITAS TENAGA KERJA SEKTOR EKONOMI PROVINSI JAWA BARAT TAHUN 2003-2017. Sarjana thesis, Universitas Siliwangi.

SOLIHATUN NISA, ANIS (2019) PENERAPAN MODEL PEMBELAJARAN PROBING PROMPTING DALAM UPAYA MENINGKATKAN HASIL BELAJAR (Studi Quasi Eksperimen Pada Mata Pelajaran Ekonomi Peserta Didik Kelas XI di SMA Negeri 3 Tasikmalaya Semester Genap Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

SUYUDI, NANDI (2018) PENGARUH MINAT BELAJAR TERHADAP HASIL BELAJAR SISWA (Studi Survei Terhadap Siswa Kelas XI IPS Pada Mata Pelajaran Ekonomi di SMA Negeri 4 Pangandaran Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

SYAHRUL RAMADHAN, ESA (2019) PENGARUH FASILITAS BELAJAR DAN MINAT BELAJAR TERHADAP HASIL BELAJAR SISWA (Survey Terhadap Mata Pelajaran Prakarya dan Kewirausahaan Kelas XII SMK Negeri 2 Tasikmalaya Semester Genap Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

SYAMSI YAH, YANI FARAMDI (2020) EFEKTIVITAS PENGENDALIAN KREDIT MACET PADA PT BANK PERKREDITAN RAKYAT SILIWANGI TASIKMALAYA KANTOR PUSAT OPERASIONAL KOTA TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Sapaat, Tatang (2018) ANALISIS PEMBERDAYAAN EKONOMI MUSTAHIK DALAM PENDAYAGUNAAN ZAKAT PRODUKTIFDI BADAN AMILZAKAT NASIONAL KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Sarah Ramadhina, Siti (2019) PENGARUH ETOS KERJA ISLAM DAN SISTEM UJRAH TERHADAP PRODUKTIVITAS KERJA PENGRAJIN TIKAR MENDONG DI MAKMUR ABADI KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Septian, Luchy Luchyana (2020) PENERAPAN PRINSIP KYC (KNOW YOUR CUSTOMER) UNTUK ANTI MONEY LAUNDERING (AML) DAN PENDANAAN TERORISME PADA PT. BANK NEGARA INDONESIA (PERSERO) Tbk. KANTOR CABANG PEMBANTU CIAMIS. Diploma thesis, Universitas Siliwangi.

Sifa, Aulia (2020) ANALISIS MANAJEMEN PRODUKSI PADA PERUSAHAAN KONVEKSI ASGAL (ASLI GALUNGGUNG) SPORT KABUPATEN TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Silviani, Elsa (2019) PENERAPAN MODEL PEMBELAJARAN COOPERATIVE TIPE GROUP INVESTIGATION (GI) TERHADAP PEMAHAMAN KONSEP BELAJAR SISWA (Studi Quasi Eksperimen Pada Mata Pelajaran Ekonomi Kelas X IPS SMA Negeri Taraju Kabupaten Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Sonjaya, Oki (2020) PROSEDUR PELAKSANAAN PEMBIAYAAN AKAD MURABAHAH PADA BNI GRIYA iB HASANAH DI PT. BANK BNI SYARIAH KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Sopandi, Opan (2019) PENERAPAN PENDEKATAN CONTEXTUAL TEACHING AND LEARNING MENGGUNAKAN MODEL PEMBELAJARAN EXAMPLE NON-EXAMPLES DALAM MENINGKATKAN KEMAMPUAN BERPIKIR ANALISIS PESERTA DIDIK (Studi Kuasi Eksperimen Pada Peserta Didik Kelas XI Jurusan Bisnis Daring dan Pemasaran (BDP) Mata Pelajaran Ekonomi Bisnis di SMK Negeri Rajapolah Kabupaten Tasikmalaya Semester Ganjil Tahun Pelajaran 2019/2020). Sarjana thesis, Universitas Siliwangi.

Sri Rahayu, Yuliana (2020) PROSEDUR PENGAJUAN KREDIT PEMILIKAN RUMAH (KPR) BTN SUBSIDI BAGI MASYARAKAT BERPENGHASILAN RENDAH (MPR) DI PT. BANK TABUNGAN NEGARA (Persero) Tbk. KANTOR CABANG TASIKMALAYA. Diploma thesis, Universitas Siliwangi.

Srigantini, Vivit (2020) EFISIENSI PENGELOLAAN DANA ZAKAT, INFAK DAN SEDEKAH PADA ORGANISASI PENGELOLA ZAKAT DI INDONESIA (Studi Kasus Pada BAZNAS dan Rumah Zakat Periode 2010-2017). Sarjana thesis, Universitas Siliwangi.

Subhiyati, Siti (2020) ANALISIS PENERAPAN PROSEDUR PEMBIAYAAN MURABAHAH KONSUMTIF PADA PEMBIAYAAN KESEJAHTERAAN PEGAWAI (PKP) DI BJB SYARIAH KCP BANJAR. Sarjana thesis, Universitas Siliwangi.

Subhiyati, Siti (2020) ANALISIS PENERAPAN PROSEDUR PEMBIAYAAN MURABAHAH KONSUMTIF PADA PEMBIAYAAN KESEJAHTERAAN PEGAWAI (PKP) DI BJB SYARIAH KCP BANJAR. Sarjana thesis, Universitas Siliwangi.

Sudiana, Sudiana and Marlina, Lina (2019) Pengaruh Kecukupan Modal dan Efisiensi Operasional terhadap Profitabilitas pada Bank CIMB Niaga Syariah. SYNTAX LITERATE : JURNAL ILMIAH INDONESIA, 4 (1). pp. 150-170. ISSN 2541-0849

Sudjoko, - and Kusmayadi, Dedi and Badruzaman, Jajang (2017) KOMPUTER AKUNTANSI SIAP PAKAI PERUSAHAAN INDUSTRI MANUFAKTUR. Hasil Reviewer. pp. 1-92. ISSN 978-979-1448-08-6

Sukarso, Aso and Hastuti Lestari Komarlina, Dwi and Budiman, Rahman (2013) Analisis Faktor Penentu Pertumbuhan Ekonomi dan Kebutuhan Investasi di Jawa Barat Tahun 2002-2011. JURNAL ILMU EKONOMI, 3 (2). pp. 588-599. ISSN 2301-8828

Sulviah Ningsih, Evi and Sukono, - and Rusyaman, Endang and Badruzaman,, Jajang (2019) Kelly's Strategy Analysis in Optimizing Investment Portfolios in Foreign Exchange. Hasil Uji Kemiripan, 8 (2S7). pp. 245-250. ISSN 277-3878

Supenti, Penti (2019) ANALISIS EFISIENSI BANK UMUM SYARIAH DI INDONESIA MENGGUNAKAN METODE DATA ENVELOPMENT ANALYSIS (DEA) Periode 2015-2017. Sarjana thesis, Universitas Siliwangi.

Surahman, Endang and Kamil, Popo Musthofa and Marlina, Lina (2016) Pengembangan Model Pembelajaran Ilmu Kealaman Dasar (IKD) Berbasis Integrasi Islam-Sains Untuk Membangun Karakter Mahasiswa Universitas Siliwangi. JURNAL SILIWANGI (Seri Pendidikan), 2 (2). pp. 92-97. ISSN 2476-9312

Surya Pratama, Chiko (2019) PENGARUH KEPEMIMPINAN DAN INSENTIF TERHADAP KINERJA KARYAWAN DI WARUNG SANGU NINI ANTEH KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Suryanto, Asep and Marlina, Lina and Rahmat, Biki Zulfikri (2020) Islamic Philanthropy: Waqf Empowerment of Madina Minimarket in Tasikmalaya Indonesia. Jurnal Ekonomi dan Bisnis Islam, IKONOMIKA, 2 (1). pp. 1-16. ISSN 2527-5143

Sutiawan, Acep (2019) ANALISIS STRATEGI PEMASARAN PADA PRODUK KEJU MOZARELLA KPBS PANGALENGAN. Sarjana thesis, Universitas Siliwangi.

Syamsiyah, YanifaRamdiatus (2020) EFEKTIVITASPENGENDALIANKREDITMACETPADAPTBANK PERKREDITANRAKYATSILIWANGITASIKMALAYAKANTORPUSAT OPERASIONALKOTATASIKMALAYA. Diploma thesis, Universitas Siliwangi.

T

TRIMULYA, MESA (2019) PENGARUH KOMPETISI DALAM KEGIATAN BELAJAR TERHADAP MOTIVASI BERPRESTASI SISWA (Survey Pada Siswa SMA Kelas XII IPS di SMAN 1 Manonjaya Pada Mata Pelajaran Ekonomi). Sarjana thesis, Universitas Siliwangi.

TRIZALDI WIDYANA, ALDI (2019) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI TABUNGAN NASIONAL DI INDONESIA PERIODE 2002-2016. Sarjana thesis, Universitas Siliwangi.

Teguh Rizal, Mohamad (2018) ANALISIS PERSEPSI PELAKU UMKM TENTANG BANK SYARIAH (Studi Penelitian pada UMKM Makanan Ringan di Kecamatan Cikoneng Kabupaten Ciamis). Sarjana thesis, Universitas Siliwangi.

Tresna, Ayu Sucita (2019) PENGARUH INDEKS NIKKEI 225, BI RATE, KURS DAN LAJU PERTUMBUHAN EKONOMI TERHADAP INDEKS HARGA SAHAM GABUNGAN (IHSG) PERIODE 2003-2017. Sarjana thesis, Universitas Siliwangi.

Tri Yunita, Anindya (2019) PENGARUH LINGKUNGAN SEKOLAH TERHADAP MOTIVASI BELAJAR DAN IMPLIKASINYA TERHADAP PRESTASI BELAJAR SISWA. Sarjana thesis, Universitas Siliwangi.

U

Ulfah Fauziyah, Elsa (2019) ANALISIS IMPLEMENTASI DISTRIBUSI HASIL DANA ZAKAT PRODUKTIF PADA MINIMARKET MADINA DI TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

V

Vikria Namania, Gina (2019) PERBANDINGAN MODEL PEMBELAJARAN INKUIRI TERBIMBING DAN GROUP INVESTIGATION DALAM MENINGKATKAN KEMAMPUAN BERPIKIR KREATIF PESERTA DIDIK PADA MATA PELAJARAN EKONOMI (Studi Quasi Eksperimen pada Mata Pelajaran Ekonomi Kelas X IPS SMA Negeri 2 Singaparna Tahun Pelajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

W

WANDINI, WIDA (2018) FAKTOR-FAKTOR YANG MEMPENGARUHI PENYERAPAN TENAGA KERJA PADA SEKTOR INDUSTRI TEKSTIL TAHUN 2006-2015 (Studi Kasus Provinsi Jawa Barat dan Provinsi Jawa Tengah). Sarjana thesis, Universitas Siliwangi.

WIDYAN DWIPUTRA, ALDI (2019) PENGARUH DESAIN PRODUK DAN PENGENDALIAN KUALITAS TERHADAP KUALITAS PRODUK (Survey Pada Pegawai Almer Kebaya Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Wihda Nurhaliza, Hany (2019) PENGARUH PENDIDIKAN KEWIRAUSAHAAN DAN DUKUNGAN SOSIAL ORANGTUA TERHADAP INTENSI BERWIRAUSAHA MAHASISWA (Survey Pada Mahasiswa Jurusan Pendidikan Ekonomi Universitas Siliwangi). Sarjana thesis, Universitas Siliwangi.

Winarti, . (2019) PENGARUH LINGKUNGAN SEKOLAH DAN PERHATIAN ORANG TUA TERHADAP MOTIVASI BELAJAR SISWA (Survei pada Siswa SMA Muhammadiyah 1 Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Windriyana, - (2019) PENGARUH ROTASI, KOMUNIKASI KARYAWAN, LINGKUNGAN KERJA DAN GAYA KEPEMIMPINAN TERHADAP KEPUASAN KERJA (Sensus pada karyawan PT. Bank Danamon Indonesia Tbk Wilayah Priangan-Timur). Sarjana thesis, Universitas Siliwangi.

Wulandari, Herna (2019) ANALISIS FAKTOR-FAKTOR INTERNAL PRODUKSI BORDIR MANUAL DALAM MENINGKATKAN DAYA SAING PERUSAHAAN DI KECAMATAN KAWALU KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

Wulandari, Wulandari (2020) PENGARUH PELATIHAN, STRES KERJA DAN PENGHARGAAN TERHADAP KINERJA KARYAWAN (Suatu Penelitian Terhadap Karyawan Departemen POSTRANS di PT. POS Indonesia (Persero) Cabang Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Wulansari, Rima (2018) MOTIF INTRINSIK DAN EKSTRINSIK TRANSAKSI KARYAWAN BANK SYARIAH DAN KARYAWAN BANK KONVENSIONAL (Studi Kasus Pada Karyawan Bank BJB Syariah Dan Karyawan Bank BJB Konvensional Di Kota Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Y

YAKUB PIRDAUS, RIKI (2019) PENGARUH KONDISI SOSIAL EKONOMI KELUARGA TERHADAP MOTIVASI BELAJAR DAN IMPLIKASINYA TERHADAP PRESTASI BELAJAR SISWA (Survey Pada Siswa Kelas XI IPS SMA Negeri Se-Kabupaten Ciamis). Sarjana thesis, Universitas Siliwangi.

YOGI KHOERULLOH, MOHAMAD (2019) PENGARUH MODAL DAN JUMLAH TENAGA KERJA TERHADAP PRODUKSI INDUSTRI KELOM DI KECAMATAN TAMANSARI. Sarjana thesis, Universitas Siliwangi.

YULIANA DEWI, ASTI (2019) PENGARUH KEPEMIMPINAN GURU DAN KEMAMPUAN BERKOMUNIKASI GURU DI KELAS TERHADAP MOTIVASI BELAJAR MATA PELAJARAN EKONOMI PADA SISWA KELAS XI IIS MAN SE-KOTA TASIKMALAYA. Sarjana thesis, Universitas Siliwangi.

YUNINDA, ATHILLA (2019) ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI KEUNTUNGAN PT. BPR CIPATUJAH JABAR PERSERODA 2008-2017. Sarjana thesis, Universitas Siliwangi.

YUNITA SARI SIALLAGAN, DIAN (2019) ANALISIS DETERMINAN KETIMPANGAN PENDAPATAN DI PROVINSI JAWA BARAT TAHUN 2008-2017. Sarjana thesis, Universitas Siliwangi.

YUSTIANA, EKA (2019) PENGARUH MODEL PEMBELAJARAN RECIPROCAL LEARNING BERBANTUKAN MEDIA LECTORA INSPIRE TERHADAP HASIL BELAJAR SISWA KELAS X IPS SMA NEGERII 1 JATIWARAS (Studi Quasi Eksperimen Pada Mata Pelajaran Ekonomi Kelas X IPS SMA Negeri 1 Jatiwaras Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

Yanari Fitri, Nelly (2019) PENGARUH INOVASI PRODUK DAN DESAIN PRODUK TERHADAP PRODUKTIVITAS (Survei pada Perusahaan Kelom Geulis Sheny Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Yanti Aulia, Risma (2019) PENERAPAN MODEL PROBLEM BASED LEARNING BERBANTUKAN MEDIA SURAT KABAR DALAM MENINGKATKAN KEMAMPUAN PEMECAHAN MASALAH SISWA (Study Quasi Eksperimen pada kelas X IPS Tahun pelajaran 2018/2019 SMA Negeri 1 Taraju Tasikmalaya). Sarjana thesis, Universitas Siliwangi.

Z

ZAKI MANGGALA PUTRA, MOHAMMAD (2019) PENGARUH ALIH FUNGSI LAHAN PERTANIAN DAN JUMLAH PENDUDUK TERHADAP KETAHANAN PANGAN BERAS KOTA TASIKMALAYA TAHUN 2012-2017. Sarjana thesis, Universitas Siliwangi.

ZAQI, MUHAMAD (2019) ANALISIS SEKTOR UNGGULAN DI KABUPATEN SUKABUMI DENGAN MENGGUNAKAN ANALISIS LOCATION QUOTIENT DAN TIPOLOGI KLASSEN. Sarjana thesis, Universitas Siliwangi.

ZULFIANA, DINI (2019) PENGARUH BRAND IMAGE PERGURUAN TINGGI DAN LINGKUNGAN SEKOLAH TERHADAP MINAT MELANJUTKAN KE PERGURUAN TINGGI (Studi Kasus: Peserta Didik Kelas XII Sekolah Menengah Kejuruan Negeri 1 Karangpucung Tahun Ajaran 2018/2019). Sarjana thesis, Universitas Siliwangi.

Zeinita, Rita (2019) ANALISIS PENDAPATAN ASLI DAERAH (PAD) DI PROVINSI JAWA BARAT (PeriodeTahun 2002 – 2017). Sarjana thesis, Universitas Siliwangi.

This list was generated on Mon Jun 14 15:53:43 2021 WIB.